KEGG   Pan troglodytes (chimpanzee): 107966150
Entry
107966150         CDS       T01005                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04110  Cell cycle
ptr04213  Longevity regulating pathway - multiple species
ptr04330  Notch signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04919  Thyroid hormone signaling pathway
ptr05016  Huntington disease
ptr05031  Amphetamine addiction
ptr05034  Alcoholism
ptr05165  Human papillomavirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107966150 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107966150 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    107966150 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107966150 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107966150 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107966150 (HDAC1)
   05202 Transcriptional misregulation in cancer
    107966150 (HDAC1)
   05206 MicroRNAs in cancer
    107966150 (HDAC1)
   05203 Viral carcinogenesis
    107966150 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107966150 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107966150 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    107966150 (HDAC1)
   05034 Alcoholism
    107966150 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    107966150 (HDAC1)
   05165 Human papillomavirus infection
    107966150 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    107966150 (HDAC1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107966150 (HDAC1)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     107966150 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     107966150 (HDAC1)
    BRAF-HDAC complex
     107966150 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107966150 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    107966150 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 107966150
NCBI-ProteinID: XP_001162233
LinkDB
Position
1
AA seq 453 aa
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGD
RLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAI
PEESGDEDEEDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEK
EKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagcctcaccgaatccgcatgactcataatttgctgctcaactatggtctctaccga
aaaatggaaatctatcgccctcacaaagccaatgctgaggagatgaccaagtaccacagc
gatgactacattaaattcttgcgctccatccgtccagataacatgtcggagtacagcaag
cagatgcagagattcaacgttggtgaggactgtccagtattcgatggcctgtttgagttc
tgtcagttgtctactggtggttctgtggcaagtgctgtgaaacttaataagcagcagacg
gacatcgctgtgaattgggctgggggcctgcaccatgcaaagaagtccgaggcatctggc
ttctgttacgtcaatgatatcgtcttggccatcctggaactgctaaagtatcaccagagg
gtgctgtatattgacattgatattcaccatggtgacggcgtggaagaggccttctatacc
acggaccgggtcatgactgtgtcctttcataagtatggagagtacttcccaggaactggg
gacctacgggatatcggggctggcaaaggcaagtattatgctgttaactacccgctccga
gacgggattgatgacgagtcctatgaggccattttcaagccggtcatgtccaaagtaatg
gagatgttccagcctagtgcggtggtcttacagtgtggctcagactccctatctggggat
cggttaggttgcttcaatctaactatcaaaggacacgccaagtgtgtggaatttgtcaag
agctttaacctgcctatgctgatgctgggaggcggtggttacaccattcgtaacgttgcc
cggtgctggacatacgagacagctgtggccctggatacggagatccctaatgagcttcca
tacaacgactactttgaatactttggaccagatttcaagctccacatcagtccttccaat
atgactaaccagaacacgaatgagtacctggagaagatcaaacagcgactgtttgagaac
cttagaatgctgccgcacgcacccggggtccaaatgcaggcgattcctgaggacgccatc
cctgaggagagtggcgatgaggacgaagaagaccctgacaagcgcatctcgatctgctcc
tctgacaaacgaattgcctgtgaggaagagttctccgattctgaagaggagggagagggg
ggccgcaagaactcttccaacttcaaaaaagccaagagagtcaaaacagaggatgaaaaa
gagaaagacccagaggagaagaaagaagttaccgaagaggagaaaaccaaggaggagaag
ccagaagccaaaggggtcaaggaggaggtcaagttggcctga

KEGG   Pan troglodytes (chimpanzee): 462950
Entry
462950            CDS       T01005                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2 isoform X2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04110  Cell cycle
ptr04213  Longevity regulating pathway - multiple species
ptr04330  Notch signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04919  Thyroid hormone signaling pathway
ptr05016  Huntington disease
ptr05031  Amphetamine addiction
ptr05034  Alcoholism
ptr05165  Human papillomavirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    462950 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    462950 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    462950 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    462950 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    462950 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    462950 (HDAC2)
   05202 Transcriptional misregulation in cancer
    462950 (HDAC2)
   05206 MicroRNAs in cancer
    462950 (HDAC2)
   05203 Viral carcinogenesis
    462950 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    462950 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    462950 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    462950 (HDAC2)
   05034 Alcoholism
    462950 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    462950 (HDAC2)
   05165 Human papillomavirus infection
    462950 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    462950 (HDAC2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     462950 (HDAC2)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     462950 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     462950 (HDAC2)
    BRAF-HDAC complex
     462950 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    462950 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    462950 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 462950
NCBI-ProteinID: XP_016811679
Ensembl: ENSPTRG00000018519
VGNC: 11094
UniProt: A0A2J8PU26
LinkDB
Position
6
AA seq 458 aa
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGD
RLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAV
HEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEED
KKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaagcctcatagaatccgcatgacccataacttgctgttaaattatggcttatacaga
aaaatggaaatatataggccccataaagccactgccgaagaaatgacaaaatatcacagt
gatgagtatatcaaatttctacggtcaataagaccagataacatgtctgagtatagtaag
cagatgcagagatttaatgttggagaagattgtccagtgtttgatggactctttgagttt
tgtcagctctcaactggcggttcagttgctggagctgtgaagttaaaccgacaacagact
gatatggctgttaattgggctggaggattacatcatgctaagaaatcagaagcatcagga
ttttgttacgttaatgatattgtgcttgccatccttgaattactaaagtatcatcagaga
gtcttatatattgatatagatattcatcatggtgatggtgttgaagaagctttttataca
acagatcgtgtaatgacggtatcattccataaatatggggaatactttcctggcacagga
gacttgagggatattggtgctggaaaaggcaaatactatgctgtcaattttccaatgaga
gatggtatagatgatgagtcatatgggcagatatttaagcctattatctcaaaggtgatg
gagatgtatcaacctagtgctgtggtattacagtgtggtgcagactcattatctggtgat
agactgggttgtttcaatctaacagtcaaaggtcatgctaaatgtgtagaagttgtaaaa
acttttaacttaccattactgatgcttggaggaggtggctacacaatccgtaatgttgct
cgatgttggacatatgagactgcagttgcccttgattgtgagattcccaatgagttgcca
tataatgattactttgagtattttggaccagacttcaaactgcatattagtccttcaaac
atgacaaaccagaacactccagaatatatggaaaagataaaacagcgtttatttgaaaat
ttgcgcatgttacctcatgcacctggtgtccagatgcaagctattccagaagatgctgtt
catgaagacagtggagatgaagatggagaagatccagacaagagaatttctattcgagca
tcagacaagcggatagcttgtgatgaagaattctcagattctgaggatgaaggagaagga
ggtcgaagaaatgtggctgatcataagaaaggagcaaagaaagctagaattgaagaagat
aagaaagaaacagaggacaaaaaaacagacgttaaggaagaagataaatccaaggacaac
agtggtgaaaaaacagataccaaaggaaccaaatcagaacagctcagcaacccctga

KEGG   Pan troglodytes (chimpanzee): 748850
Entry
748850            CDS       T01005                                 

Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04110  Cell cycle
ptr04213  Longevity regulating pathway - multiple species
ptr04330  Notch signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04919  Thyroid hormone signaling pathway
ptr05016  Huntington disease
ptr05031  Amphetamine addiction
ptr05034  Alcoholism
ptr05165  Human papillomavirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    748850
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    748850
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    748850
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    748850
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    748850
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    748850
   05202 Transcriptional misregulation in cancer
    748850
   05206 MicroRNAs in cancer
    748850
   05203 Viral carcinogenesis
    748850
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    748850
  09164 Neurodegenerative disease
   05016 Huntington disease
    748850
  09165 Substance dependence
   05031 Amphetamine addiction
    748850
   05034 Alcoholism
    748850
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    748850
   05165 Human papillomavirus infection
    748850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    748850
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     748850
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     748850
   HDAC complexes
    Sin3A-HDAC complex
     748850
    BRAF-HDAC complex
     748850
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    748850
  Chromatin remodeling factors
   NuRD complex
    748850
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 748850
NCBI-ProteinID: XP_024200974
LinkDB
Position
8
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagacgcagggcactcggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccatggt
gacggcgtggaagaggccttctataccacggaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc
ggtggttacaccattcgtaacgttgcccggtgctggacatacgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaacgactactttgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacccggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagaagac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagttacc
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system