KEGG   Pan troglodytes (chimpanzee): 107967644Help
Entry
107967644         CDS       T01005                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00010  Glycolysis / Gluconeogenesis
ptr00053  Ascorbate and aldarate metabolism
ptr00071  Fatty acid degradation
ptr00280  Valine, leucine and isoleucine degradation
ptr00310  Lysine degradation
ptr00330  Arginine and proline metabolism
ptr00340  Histidine metabolism
ptr00380  Tryptophan metabolism
ptr00410  beta-Alanine metabolism
ptr00561  Glycerolipid metabolism
ptr00620  Pyruvate metabolism
ptr01100  Metabolic pathways
Module
ptr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107967644 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    107967644 (ALDH2)
   00620 Pyruvate metabolism
    107967644 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107967644 (ALDH2)
   00561 Glycerolipid metabolism
    107967644 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107967644 (ALDH2)
   00310 Lysine degradation
    107967644 (ALDH2)
   00330 Arginine and proline metabolism
    107967644 (ALDH2)
   00340 Histidine metabolism
    107967644 (ALDH2)
   00380 Tryptophan metabolism
    107967644 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107967644 (ALDH2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107967644 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 107967644
NCBI-ProteinID: XP_016779748
VGNC: 52040
UniProt: K7B7G6
LinkDB All DBs
Position
12
AA seq 517 aa AA seqDB search
MFRAAACLGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcgctgccgcctgcctcgggccccgcctgggccgccgcctcttgtcagccgcc
gccacccaggccgtgcctgcccccaaccagcagcccgaggtcttctgcaaccagattttc
ataaacaatgaatggcacgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggctgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
attcccattgacggagacttcttcagctacacacgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcaactggaaacgtggttgtgatgaaggtagctgagcagacacccctcaccgccctctat
gtggccaacctgatcaaggaggctggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacggctggggccgccattgcctcccatgaggatgtggacaaagtggcattc
acaggctccactgagattggccgcgtaatccaggttgctgctgggagcagcaacctcaag
agagtgaccttggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatccttggctacatcaacacggggaaacaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagttgggcgagtacggcctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

DBGET integrated database retrieval system