KEGG   Pan troglodytes (chimpanzee): 107969994
Entry
107969994         CDS       T01005                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04110  Cell cycle
ptr04137  Mitophagy - animal
ptr04218  Cellular senescence
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107969994 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    107969994 (E2F1)
   04218 Cellular senescence
    107969994 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107969994 (E2F1)
   05206 MicroRNAs in cancer
    107969994 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107969994 (E2F1)
   05225 Hepatocellular carcinoma
    107969994 (E2F1)
   05226 Gastric cancer
    107969994 (E2F1)
   05214 Glioma
    107969994 (E2F1)
   05220 Chronic myeloid leukemia
    107969994 (E2F1)
   05218 Melanoma
    107969994 (E2F1)
   05219 Bladder cancer
    107969994 (E2F1)
   05215 Prostate cancer
    107969994 (E2F1)
   05224 Breast cancer
    107969994 (E2F1)
   05222 Small cell lung cancer
    107969994 (E2F1)
   05223 Non-small cell lung cancer
    107969994 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107969994 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107969994 (E2F1)
   05161 Hepatitis B
    107969994 (E2F1)
   05160 Hepatitis C
    107969994 (E2F1)
   05163 Human cytomegalovirus infection
    107969994 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107969994 (E2F1)
   05169 Epstein-Barr virus infection
    107969994 (E2F1)
   05165 Human papillomavirus infection
    107969994 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107969994 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    107969994 (E2F1)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107969994 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 107969994
NCBI-ProteinID: XP_003316910
VGNC: 6098
UniProt: K7CCS1
LinkDB
Position
20
AA seq 437 aa
MALAGAPAGGPCAPALEALLGAGALQLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEATSEEENRATDSATIVSPPPSSLPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccttggccggggcccctgcgggcggcccatgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcagctgctcgactcctcgcagatcgtcatcatctccgccgcgcag
gacgccagcgccccgccggctcccaccggccccgcggcgcccgctgccggcccctgcgac
cctgacctgctgctcttcgccacaccgcaggcgccccggcccacacccagtgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcagtac
ctggccgagagcagtgggccagctcggggcagaggccgccatccaggaaaaggtgtgaaa
tccccgggggagaagtcacgctatgagacctcactgaatctgaccaccaagcgcttcctg
gagctgctgagccactcggctgacggtgtcgtcgacctgaactgggctgccgaggtgctg
aaggtgcagaagcggcgcatctatgacatcaccaacgtccttgagggcatccagctcatt
gccaagaagtccaagaaccacatccagtggctgggcagccacaccacagtgggcgtcggc
ggacggcttgaggggttgacccaggacctccgacagctgcaggagagcgagcagcagctg
gaccacctgatgaatatctgtactacgcagctgcgcctgctctccgaggacactgacagc
cagcgcctggcctacgtgacgtgtcaggaccttcgtagcattgcagaccctgcagagcag
atggttatggtgatcaaagcccctcctgagacccagctccaagccgtggactcttcggag
acctttcagatctcccttaagagcaaacaaggcccgatcgatgttttcctgtgccctgag
gagaccgtaggtgggatcagccctgggaagaccccatcccaggaggccacttctgaggag
gagaacagggccactgactctgccaccatagtgtcaccaccaccatcatctctcccctca
tccctcaccacagatcccagccagtctctactcagcctggagcaagaaccgctgttgtcc
cggatgggcagcctgcgggctcccgtggacgaggaccgcctgtccccgctggtggcggcc
gactcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttcatc
agcctttccccaccccacgaggccctcgactaccacttcggcctcgaggagggcgagggc
atcagagacctcttcgactgtgactttggggacctcacccccctggatttctga

KEGG   Pan troglodytes (chimpanzee): 469153
Entry
469153            CDS       T01005                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X2
  KO
K09389  transcription factor E2F2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04110  Cell cycle
ptr04218  Cellular senescence
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    469153 (E2F2)
   04218 Cellular senescence
    469153 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    469153 (E2F2)
   05206 MicroRNAs in cancer
    469153 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    469153 (E2F2)
   05225 Hepatocellular carcinoma
    469153 (E2F2)
   05226 Gastric cancer
    469153 (E2F2)
   05214 Glioma
    469153 (E2F2)
   05220 Chronic myeloid leukemia
    469153 (E2F2)
   05218 Melanoma
    469153 (E2F2)
   05219 Bladder cancer
    469153 (E2F2)
   05215 Prostate cancer
    469153 (E2F2)
   05224 Breast cancer
    469153 (E2F2)
   05222 Small cell lung cancer
    469153 (E2F2)
   05223 Non-small cell lung cancer
    469153 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    469153 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    469153 (E2F2)
   05161 Hepatitis B
    469153 (E2F2)
   05160 Hepatitis C
    469153 (E2F2)
   05163 Human cytomegalovirus infection
    469153 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    469153 (E2F2)
   05169 Epstein-Barr virus infection
    469153 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    469153 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    469153 (E2F2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    469153 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 469153
NCBI-ProteinID: XP_009448901
Ensembl: ENSPTRG00000000330
VGNC: 525
LinkDB
Position
1
AA seq 435 aa
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQGRGMFEDPTRPGKQQQLGQELKELMNMEQALDQLIQSCSLSFKHLTEDK
ANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEVYL
CPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPP
PSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGI
SDLFDSYDLGDLLIN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggcttcggccgctgggcagaccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actgctacctactacacaccgctgtacccgcagacggcgcctcccgcagcggcgccaggc
acctgcctcgacgccactccccacggacccgagggccaagttgtgcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcccgtcgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacttcgctagggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggaaggcatccag
ctcatccgcaagaaggccaagaacaacatccaaggcaggggaatgtttgaagaccccacc
agacctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatggagcag
gccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgaggacaag
gccaacaagaggctggcctatgtgacttaccaggatatccgtgctgttggcaactttaag
gagcagacagtgattgccgtcaaggcccctccgcagacgagactggaagtgcccgacagg
actgaggacaacctgcagatatatctcaagagcacccaagggcccatcgaagtctacctg
tgcccagaggaggtgcaggagccggacagtccttccgaggagcctctcccctctacctcc
accctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagcatcatg
gagcccacagcatcctcagtgccagcaccagcgccaaccccccagcaggccccaccgcct
ccatccctggtccccttggaggctactgacagcatgctggagctgccgcacccactcctg
cagcagactgaggaccagttcctgtccccgaccctggcatgcagctcccctctgatcagc
ttctccccatccttggaccaggacgactacctgtggggcttggaggcgggtgagggcatc
agcgacctcttcgactcctacgaccttggggacctgttgattaattga

KEGG   Pan troglodytes (chimpanzee): 471865
Entry
471865            CDS       T01005                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04110  Cell cycle
ptr04218  Cellular senescence
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    471865 (E2F3)
   04218 Cellular senescence
    471865 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    471865 (E2F3)
   05206 MicroRNAs in cancer
    471865 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    471865 (E2F3)
   05225 Hepatocellular carcinoma
    471865 (E2F3)
   05226 Gastric cancer
    471865 (E2F3)
   05214 Glioma
    471865 (E2F3)
   05220 Chronic myeloid leukemia
    471865 (E2F3)
   05218 Melanoma
    471865 (E2F3)
   05219 Bladder cancer
    471865 (E2F3)
   05215 Prostate cancer
    471865 (E2F3)
   05224 Breast cancer
    471865 (E2F3)
   05222 Small cell lung cancer
    471865 (E2F3)
   05223 Non-small cell lung cancer
    471865 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    471865 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471865 (E2F3)
   05161 Hepatitis B
    471865 (E2F3)
   05160 Hepatitis C
    471865 (E2F3)
   05163 Human cytomegalovirus infection
    471865 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    471865 (E2F3)
   05169 Epstein-Barr virus infection
    471865 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    471865 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    471865 (E2F3)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    471865 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 471865
NCBI-ProteinID: XP_016810466
VGNC: 11064
UniProt: A0A6D2VUJ9 A0A2I3RS40
LinkDB
Position
6
AA seq 465 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQI
LTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALG
RGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYD
TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
YQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSP
MKTNNQDHNGNIPKPASKDLASTNSGHSDCSISMGNLSPLASPANLLQQTEDQIPSNLEG
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgctctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttcgccgccgccgccgccgctgccgccgccccgggcgcgtacatccagatc
ctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgccgtagcc
gccggccccctcctccccagtgcccccggcgcggagcagaccgccggcagcctcctctac
accacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcgctggga
cgcggcggcagcggcggcggcggcggccctccggcaaagcgaaggctggagctaggagaa
agcggtcatcagtacctctcagatggtttaaaaacccccaagggcaaaggaagagctgca
ctacgaagtccagatagtccaaaaactccaaaatctccctcagaaaaaacgcggtatgat
acgtctcttggtctgctcaccaagaagttcattcagctcctgagccagtcacccgatggg
gtattggatttgaacaaggcagcagaagtgctaaaagtgcaaaagagaaggatttatgat
atcaccaacgttctggaaggcatccacctcattaagaagaagtctaaaaacaacgtccaa
tggatgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtca
aaagaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgc
accctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttaca
tatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcc
cctccagaaacaagacttgaagtgcctgactcaatagagagcctacaaatacatttggca
agtacccaagggcccattgaggtttacttatgtccagaagagactgaaacacacagtcca
atgaaaacaaacaaccaagaccacaatgggaatatccctaaacccgcttccaaagacttg
gcttcaaccaactcaggacatagcgattgctcaatttctatgggaaacctttctcctctg
gcctccccagccaacctcttacagcagactgaggaccaaattccttccaacctagaagga
ccctttgtgaacttactgcctcccctgctgcaagaggactatctcctgagcctcggggag
gaggaaggcatcagcgatctcttcgatgcttacgatttggaaaagctcccactggtggaa
gacttcatgtgtagttga

DBGET integrated database retrieval system