KEGG   Pan troglodytes (chimpanzee): 107970369
Entry
107970369         CDS       T01005                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04015  Rap1 signaling pathway
ptr04062  Chemokine signaling pathway
ptr04510  Focal adhesion
ptr04666  Fc gamma R-mediated phagocytosis
ptr04722  Neurotrophin signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05100  Bacterial invasion of epithelial cells
ptr05135  Yersinia infection
ptr05163  Human cytomegalovirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05211  Renal cell carcinoma
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107970369 (CRKL)
   04012 ErbB signaling pathway
    107970369 (CRKL)
   04015 Rap1 signaling pathway
    107970369 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107970369 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107970369 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107970369 (CRKL)
   04062 Chemokine signaling pathway
    107970369 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107970369 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    107970369 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107970369 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107970369 (CRKL)
   05206 MicroRNAs in cancer
    107970369 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    107970369 (CRKL)
   05211 Renal cell carcinoma
    107970369 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107970369 (CRKL)
   05100 Bacterial invasion of epithelial cells
    107970369 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107970369 (CRKL)
   05163 Human cytomegalovirus infection
    107970369 (CRKL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    107970369 (CRKL)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   107970369 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 107970369
NCBI-ProteinID: XP_016795233
VGNC: 12833
UniProt: A0A6D2Y4N2 H2R472
LinkDB
Position
22
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtacatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggaatttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccacccttatcgag
cctgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccaacctgcctaca
gcagaagataacctggaatatgtacggactctgtatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaac
gggcgcaaagggcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

KEGG   Pan troglodytes (chimpanzee): 747142
Entry
747142            CDS       T01005                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04015  Rap1 signaling pathway
ptr04062  Chemokine signaling pathway
ptr04510  Focal adhesion
ptr04666  Fc gamma R-mediated phagocytosis
ptr04722  Neurotrophin signaling pathway
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05100  Bacterial invasion of epithelial cells
ptr05135  Yersinia infection
ptr05163  Human cytomegalovirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05206  MicroRNAs in cancer
ptr05211  Renal cell carcinoma
ptr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    747142 (CRK)
   04012 ErbB signaling pathway
    747142 (CRK)
   04015 Rap1 signaling pathway
    747142 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    747142 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    747142 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    747142 (CRK)
   04062 Chemokine signaling pathway
    747142 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    747142 (CRK)
   04935 Growth hormone synthesis, secretion and action
    747142 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    747142 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    747142 (CRK)
   05206 MicroRNAs in cancer
    747142 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    747142 (CRK)
   05211 Renal cell carcinoma
    747142 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    747142 (CRK)
   05100 Bacterial invasion of epithelial cells
    747142 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    747142 (CRK)
   05163 Human cytomegalovirus infection
    747142 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    747142 (CRK)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   747142 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 747142
NCBI-ProteinID: XP_016786611
Ensembl: ENSPTRG00000008522
VGNC: 12058
UniProt: K7D4Z8 A0A6D2WS42
LinkDB
Position
17
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggttgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctcagagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgctcagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcttgaga
atccgggacaagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatatatgcc
agggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system