KEGG   Pan troglodytes (chimpanzee): 107972404
Entry
107972404         CDS       T01005                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3 isoform X1
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04218  Cellular senescence
ptr04620  Toll-like receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04714  Thermogenesis
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05145  Toxoplasmosis
ptr05161  Hepatitis B
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107972404
   04015 Rap1 signaling pathway
    107972404
   04668 TNF signaling pathway
    107972404
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107972404
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107972404
   04664 Fc epsilon RI signaling pathway
    107972404
  09152 Endocrine system
   04912 GnRH signaling pathway
    107972404
   04935 Growth hormone synthesis, secretion and action
    107972404
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107972404
  09159 Environmental adaptation
   04714 Thermogenesis
    107972404
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107972404
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107972404
   05022 Pathways of neurodegeneration - multiple diseases
    107972404
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107972404
   05135 Yersinia infection
    107972404
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107972404
   05161 Hepatitis B
    107972404
   05169 Epstein-Barr virus infection
    107972404
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107972404
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107972404
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   107972404
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1 DUF4344
Other DBs
NCBI-GeneID: 107972404
NCBI-ProteinID: XP_024206180
LinkDB
Position
17
AA seq 357 aa
MAQRPKGAKFSVGPCEEKAGAAEASGGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFI
TIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMD
LDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIA
VSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPY
MAPERINPELNQKGYNVKSDVWSLGITMIEMAILWFPYESWGTPFQQLKQVVEEPSPQLP
ADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggcccagcgcccaaagggagcaaagttctcagttggcccgtgtgaggagaaggccggg
gcagcggaggcttccggcggaaaatccaagaggaagaaggatctacggatatcctgcatg
tccaagccacccgcacccaaccccacacccccccggaacctggactcccggaccttcatc
accattggagacagaaactttgaggtggaggctgatgacttggtgaccatctcagaactg
ggccgcggagcctatggggtggtagagaaggtgcggcacgcccagagtggcaccatcatg
gctgtgaagcggatccgggccactgtgaactcacaggagcagaagcggctgctcatggac
ctggacatcaacatgcgcacggtcgactgcttctacactgtcaccttctacggggcacta
ttcagagagggagatgtgtggatctgcatggagctcatggacacatccttggacaagttc
taccggaaggtgctggataaaaacatgacaattccagaggacatccttggggagattgct
gtgtctatcgtgcgggccctggagcatctgcacagcaagctgtcggtgatccacagagat
gtgaagccctccaatgtccttatcaacaaggagggccatgtgaagatgtgtgactttggc
atcagtggctacttggtggactctgtggccaagacgatggatgccggctgcaagccctac
atggcccctgagaggatcaacccagagctgaaccagaagggctacaatgtcaagtccgac
gtctggagcctgggcatcaccatgattgagatggccatcctgtggttcccttacgagtcc
tgggggaccccgttccagcagctgaagcaggtggtggaggagccatccccccagctccca
gccgaccgtttctcccccgagtttgtggacttcactgctcagtgcctgaggaagaacccc
gcagagcgtatgagctacctggagctgatggagcaccccttcttcaccttgcacaaaacc
aagaagacggacattgctgccttcgtgaaggagatcctgggagaagactcatag

KEGG   Pan troglodytes (chimpanzee): 112206088
Entry
112206088         CDS       T01005                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3-like
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04218  Cellular senescence
ptr04620  Toll-like receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04714  Thermogenesis
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05145  Toxoplasmosis
ptr05161  Hepatitis B
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112206088
   04015 Rap1 signaling pathway
    112206088
   04668 TNF signaling pathway
    112206088
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112206088
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112206088
   04664 Fc epsilon RI signaling pathway
    112206088
  09152 Endocrine system
   04912 GnRH signaling pathway
    112206088
   04935 Growth hormone synthesis, secretion and action
    112206088
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112206088
  09159 Environmental adaptation
   04714 Thermogenesis
    112206088
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112206088
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    112206088
   05022 Pathways of neurodegeneration - multiple diseases
    112206088
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112206088
   05135 Yersinia infection
    112206088
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112206088
   05161 Hepatitis B
    112206088
   05169 Epstein-Barr virus infection
    112206088
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112206088
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     112206088
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   112206088
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 112206088
NCBI-ProteinID: XP_024206446
LinkDB
Position
17
AA seq 217 aa
MQARCPQQSTWSPAFLAVAGPGRARPACSLRTKYDSQLARHLLQPQFPGLTLGTLVEPAH
WGMGGGTGGVLGEGGGHSYAEHGTCLQSCSTDVAEACPSLVDVKPSNVLINKEGHVKICD
FGISGYLVDFVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILWFPY
ESWGTPFQPLKQVVDEPSPQLPADRFSPESVDFTAQW
NT seq 654 nt   +upstreamnt  +downstreamnt
atgcaggcacggtgcccccagcaaagcacctggagtcctgccttccttgcagtggccggg
ccgggccgggcacgtcctgcctgttccctgaggaccaagtatgactctcagctggcccgg
cacctcttgcagcctcagttccctggtctgacccttgggaccctggtggaacctgcccac
tggggcatgggagggggcacaggaggggtcttgggtgagggaggggggcacagctatgca
gagcatggcacctgcctccagtcatgctccacagacgtggctgaggcatgtccctccctg
gtagatgtgaagccctccaatgtccttatcaacaaggagggccatgtgaagatatgtgac
tttggcatcagtggctacttggtggactttgtggccaagacgatggatgccggctgcaag
ccctacatggcccctgagaggatcaacccagagctgaaccagaagggctacaatgtcaag
tccgacgtctggagcctgggcatcaccatgattgagatggccatcctgtggttcccttat
gagtcctgggggaccccgttccagccgctgaagcaggtggtggatgagccgtcaccccag
ctcccagctgaccgtttctcccccgagtctgtggacttcactgctcagtggtga

KEGG   Pan troglodytes (chimpanzee): 468310
Entry
468310            CDS       T01005                                 

Gene name
MAP2K6
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6 isoform X2
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04015  Rap1 signaling pathway
ptr04218  Cellular senescence
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04912  GnRH signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05014  Amyotrophic lateral sclerosis
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05145  Toxoplasmosis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    468310 (MAP2K6)
   04015 Rap1 signaling pathway
    468310 (MAP2K6)
   04668 TNF signaling pathway
    468310 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    468310 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    468310 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    468310 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    468310 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    468310 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    468310 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    468310 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    468310 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    468310 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    468310 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    468310 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    468310 (MAP2K6)
   05135 Yersinia infection
    468310 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    468310 (MAP2K6)
   05161 Hepatitis B
    468310 (MAP2K6)
   05163 Human cytomegalovirus infection
    468310 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    468310 (MAP2K6)
   05169 Epstein-Barr virus infection
    468310 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    468310 (MAP2K6)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     468310 (MAP2K6)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   468310 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal DUF4344 Choline_kinase APH
Other DBs
NCBI-GeneID: 468310
NCBI-ProteinID: XP_009431432
Ensembl: ENSPTRG00000009588
VGNC: 9365
UniProt: A0A6D2XQ66 A0A2J8KKV2
LinkDB
Position
17
AA seq 278 aa
MELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFY
GALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVI
HRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSV
KSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLK
KNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 837 nt   +upstreamnt  +downstreamnt
atggaactgggacgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcggg
cagatcatggcagtgaagcggatccgagccacagtaaatagccaggaacagaaacggcta
ctgatggatttggatatttccatgaggacggtggactgtccattcactgtcaccttttat
ggcgcactgtttcgggagggtgatgtgtggatctgcatggagctcatggatacatcacta
gataaattctacaaacaagttattgataaaggccagacaattccagaggacatcttaggg
aaaatagcagtttctattgtaaaagcattagaacatttacatagtaagctgtctgtcatt
cacagagatgtcaagccttctaatgtactcatcaatgctctcggtcaagtgaagatgtgc
gattttggaatcagtggctacttggtggactctgttgctaaaacaattgatgcaggttgc
aaaccatacatggcccctgaaagaataaacccagagctcaaccagaagggatacagtgtg
aagtctgacatttggagtctgggcatcacgatgattgagttggccatccttcgatttccc
tatgattcatggggaactccatttcagcagctcaaacaggtggtagaggagccatcgcca
caactcccagcagacaagttctctgcagagtttgttgactttacctcacagtgcttaaag
aagaattccaaagaacggcctacatacccagagctaatgcaacatccatttttcacccta
catgaatccaaaggaacagatgtggcatcttttgtaaaactgattcttggagactaa

DBGET integrated database retrieval system