KEGG   Pan troglodytes (chimpanzee): 107973001
Entry
107973001         CDS       T01005                                 

Gene name
GOLGA6B
Definition
(RefSeq) golgin subfamily A member 6B isoform X1
  KO
K20358  golgin subfamily A member 2
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    107973001 (GOLGA6B)
Membrane trafficking [BR:ptr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107973001 (GOLGA6B)
SSDB
Motif
Pfam: GOLGA2L5 GM130_C
Other DBs
NCBI-GeneID: 107973001
NCBI-ProteinID: XP_024205044
LinkDB
Position
15
AA seq 739 aa
MPPLAQSHSSLVGDWRCSLMWPQPYLPPHPMILEETRQNKLAAAKKKLKEYQQRKSPGVP
AGAKTKKKKTDSSPETTTSGGCHSPGDSQYQELAVALESSSVTINQLNENIESLKQQKKQ
VEHQLEEAKKTNNEIHKAQMEQLETINILTLEKADLKTTLYRTKRAARHFEEESKDLAGR
LQYSLQRIQELERALCAVSTQQQEEDRSSSCSEAVLQRRLQQTIKERALLNTHVTQVTES
LKQVQLERDEYAKHIKGERARWQERMWKMSVEARTLKEEKKCDIHRIQELERSLSELKNQ
MAKPPSLAPPAVTSVVEQLQDEAKHLRQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQE
QEEMLREQEAQRVREQERLCEQNERLREQQKTLQEQGERLRKQEQRLRKQEERLRKEEER
LQKQEKRLWDQEERLWKKEERLQKQEERLALSQNHKLDKQLAEPQCSFEDLNNEKKSTLQ
LEQQVKELQEKLDEEPAASHQNQQLETQLSLVALPGEGDGGEHLDSEEEEAPRPMPNIPE
DLESWEATSSFMDLPKEKADGTEQVERLELGFVQPSGATDGMRQSFTVYESQGAVPNTRH
QEMEDVIRLAQKEEEMKVKLLELQELVLPLVGNHEGHGKFLIAAQNPADEPTPGAPAPQE
LGAAGEQDDFYEVSLDNNVEPAPGAAREGSLHDNPTAQQIVQLPPVMQDTQEHPGLPSKP
RVPFFYQAAENREINIIIF
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgcctcctctggctcagtcacacagcagccttgtaggtgactggaggtgttcgctgatg
tggccccaaccctacctccctccccaccccatgatattagaagaaacacgacagaacaaa
ttggcagcagccaagaaaaagctaaaagaatatcagcaaaggaagagccctggtgttcca
gcaggagcaaagacaaaaaagaaaaaaactgacagtagccctgagacaaccacttctggt
ggttgccactcacctggggacagccagtaccaagaactagcagtagccctggagtcaagc
tccgtgacaatcaatcaactcaatgaaaacatagaatcattgaaacagcagaagaaacaa
gtggaacatcagctggaagaagcaaagaaaacaaacaatgaaatacacaaagcacaaatg
gagcagttagagacaatcaacatcctcacattggaaaaggcagacttgaagaccaccctt
taccgtactaaacgtgctgcccgacacttcgaagaagagtccaaggatctggctggccgc
ctgcaatactccttacagcgtattcaagaattggagcgggctctctgtgctgtgtctaca
cagcagcaggaagaggacaggtcctcgagctgcagtgaagcggtcctccagcggcggttg
cagcagaccataaaggagcgggcgctgctgaacacacacgtgacacaggtgacagagtca
ctaaaacaagtccagctagagcgagacgaatacgctaaacacataaaaggagagagggcc
cggtggcaggagaggatgtggaaaatgtcggtggaggctcgaacattgaaggaagagaag
aagtgcgacatacatcggatacaggagctggagaggagcttgtctgaactcaaaaaccag
atggctaagcccccatccctggcgcccccagcagtgacctctgtggtggaacagctacaa
gatgaggccaaacacctgaggcaggaggtggaaggtctggagggaaagctccaatcccag
gtggaaaacaatcaggccttgagtctccttagcaaggaacaaaagcagagactccaggag
caggaggagatgctccgagagcaggaggcgcagagagtgcgggagcaggagagactgtgt
gaacaaaacgagaggcttcgggagcagcagaagacgctacaggagcagggtgagaggctg
cgaaagcaggagcagaggctacgcaagcaggaggagaggctgcgaaaggaggaggagagg
ctgcaaaagcaggaaaagaggctgtgggaccaggaggagaggctgtggaagaaggaggag
aggctacaaaagcaggaggagaggcttgcgctctcccagaaccacaagctcgacaagcag
ctggccgagccacagtgcagcttcgaggatctgaacaacgagaaaaagagcacactgcag
ctggagcagcaagtaaaggagctgcaggagaagctagacgaggaaccagctgccagccac
cagaaccaacagctagagacccagctaagcctcgtggctctccctggagaaggagatgga
ggagaacatctggacagtgaggaggaggaggcgcctcggcccatgccaaacatcccagag
gacctggagagctgggaggccacgagcagctttatggacctcccgaaggagaaggcggac
gggacggagcaggtggagagactagagcttggattcgtccagccctctggagcgacagat
ggcatgagacagtccttcaccgtatatgaaagccagggggcagtgccaaacacgcggcac
caggagatggaggatgtcatcaggctggcccagaaggaggaggagatgaaggtgaagctg
ctggagctgcaagagttggtgttgccccttgtgggcaaccatgaggggcatggcaaattc
ctcatcgctgcccagaaccctgctgatgagcccactccaggggccccagccccccaggaa
cttggggctgccggtgagcaggatgatttttatgaagtgagcctggacaacaatgtggag
cctgcaccaggagcggccagggagggttctctccatgacaaccccactgcacagcagatc
gtgcagctgcctcctgtaatgcaggacacccaggagcacccaggcttgcccagcaaaccc
cgcgtgccattcttttaccaggcagccgagaacagggagataaacatcatcatcttctaa

DBGET integrated database retrieval system