KEGG   Pan troglodytes (chimpanzee): 107974583Help
Entry
107974583         CDS       T01005                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00020  Citrate cycle (TCA cycle)
ptr00190  Oxidative phosphorylation
ptr01100  Metabolic pathways
ptr01200  Carbon metabolism
ptr04714  Thermogenesis
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05016  Huntington disease
Module
ptr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ptr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107974583 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107974583 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    107974583 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    107974583 (SDHA)
   05012 Parkinson disease
    107974583 (SDHA)
   05016 Huntington disease
    107974583 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    107974583 (SDHA)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107974583 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107974583
NCBI-ProteinID: XP_016808353
VGNC: 7150
LinkDB All DBs
Position
5
AA seq 664 aa AA seqDB search
MSRVRGLSRLLSARRLALAKAWPAVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGVHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgggtccggggcctgtcgcggctgctgagcgctcggcgcctggcgctggccaag
gcgtggccagcagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcgcagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacggagcaggcccccgccgccgtggtcgagctagaaaattatggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggactggccactcgcta
ttgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaacggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcactggcgacggcacggccatgatc
accagggcaggccttccttgccaggacctcgagtttgttcagttccaccccacaggcata
tatggtgctggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggcgaaaggtttatggagcgatacgcccctgtcgcgaaggacctggcgtctaga
gatgtggtgtctcggtcgatgactctggagatccgagaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctacctccagagcagctggccacgcgcctg
cctggcatttcagagacagccatgatcttcgctggcgtggacgtcacgaaggagccgatc
cctgtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcctggcctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccgccttggggcaaactcgctcttggacctg
gttgtctttggtcgggcatgtgccctgagcatcgaagagtcatgcaggcctggagataaa
gtccctccaattaaaccaaacgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgatggaagcataagaacatcggaactgcgactcaacatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagc
aagctctatggagacctaaagcacctgaagacgttcgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcgcggaaggagtcacggggcgtgcatgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccctttgaggag
cactggagaaagcacaccctgtcgtatgtggacgttggcactgggaaggtcactctggaa
tatagacccgtaatcgacaaaactttgaacgaggctgactgtgccaccgtcccgccagcc
attcgctcctactga

DBGET integrated database retrieval system