KEGG   Pan troglodytes (chimpanzee): 107975108
Entry
107975108         CDS       T01005                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04022  cGMP-PKG signaling pathway
ptr04141  Protein processing in endoplasmic reticulum
ptr04151  PI3K-Akt signaling pathway
ptr04211  Longevity regulating pathway
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04668  TNF signaling pathway
ptr04728  Dopaminergic synapse
ptr04911  Insulin secretion
ptr04915  Estrogen signaling pathway
ptr04918  Thyroid hormone synthesis
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr05020  Prion disease
ptr05030  Cocaine addiction
ptr05031  Amphetamine addiction
ptr05034  Alcoholism
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107975108 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107975108 (ATF6B)
   04022 cGMP-PKG signaling pathway
    107975108 (ATF6B)
   04151 PI3K-Akt signaling pathway
    107975108 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107975108 (ATF6B)
   04915 Estrogen signaling pathway
    107975108 (ATF6B)
   04926 Relaxin signaling pathway
    107975108 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    107975108 (ATF6B)
   04918 Thyroid hormone synthesis
    107975108 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    107975108 (ATF6B)
   04925 Aldosterone synthesis and secretion
    107975108 (ATF6B)
   04927 Cortisol synthesis and secretion
    107975108 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107975108 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107975108 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    107975108 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107975108 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    107975108 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    107975108 (ATF6B)
   05031 Amphetamine addiction
    107975108 (ATF6B)
   05034 Alcoholism
    107975108 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107975108 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107975108 (ATF6B)
   05161 Hepatitis B
    107975108 (ATF6B)
   05163 Human cytomegalovirus infection
    107975108 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    107975108 (ATF6B)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107975108 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 107975108
NCBI-ProteinID: XP_001151201
UniProt: H2RCD1
LinkDB
Position
6
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFEGSSLDVGMDVSPPEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCS
SVNSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGS
SGKALPTRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKMVCIMVFLLFIAFNFG
PVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQP
SFSNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDHSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPFYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgctgac
ccgacgcgtttcttcaccgacaacctgcttagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctctttcgttgcccg
gagcaggatgtcccgtttgagggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccaatcttcccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctccctcagctccgagtcatcgcgtctctccacagagccatcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccgtccagatcaacgttatc
cccacctctgatgattcctcagatgtccagaccaagatagaacctgtctctccatgttct
tccgtcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctctccccttcaggatgcctcctttgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccttgatggctcc
tcagggaaagccctgcccacccggaagccaccactgcagcccaaacctgtagtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctc
gtccagccacccccagtgtccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctccctctctaccacggcctgagaggaagagcatcgttcccgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaagaaagagtatctgcaggga
ctggaggctcggctgcaagcagtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaagatggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cctgtcagcatcagtgagcctccttcagctcccatctctcctcggatgaacaagggggag
cctcaaccccggagacacttgctggggttctcggagcaagagccagttcagggagttgaa
cctctccaggggtcctcccagggccctaaggagccccagcccagccccacagaccagccc
agtttcagcaacctgacagccttccctgggggcgccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcactgagtccctgaggctt
gctgacgagttgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccggaaagggattctgtgggccagctgcaactatatcgc
cacccagaccattcgcagccagcgttcttggatgcaattgaccgacgggaagacacattt
tatgttgtatctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacagtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcctctgcagccagccaggcccaccag
gcctcccaccagcccttctacctcaatcatccctga

DBGET integrated database retrieval system