KEGG   Pan troglodytes (chimpanzee): 112205915
Entry
112205915         CDS       T01005                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative 3-phosphoinositide-dependent protein kinase 2
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01524  Platinum drug resistance
ptr03320  PPAR signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04510  Focal adhesion
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04931  Insulin resistance
ptr04960  Aldosterone-regulated sodium reabsorption
ptr05145  Toxoplasmosis
ptr05205  Proteoglycans in cancer
ptr05213  Endometrial cancer
ptr05215  Prostate cancer
ptr05223  Non-small cell lung cancer
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112205915
   04071 Sphingolipid signaling pathway
    112205915
   04151 PI3K-Akt signaling pathway
    112205915
   04152 AMPK signaling pathway
    112205915
   04150 mTOR signaling pathway
    112205915
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112205915
  09143 Cell growth and death
   04210 Apoptosis
    112205915
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112205915
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112205915
   04664 Fc epsilon RI signaling pathway
    112205915
  09152 Endocrine system
   04910 Insulin signaling pathway
    112205915
   03320 PPAR signaling pathway
    112205915
   04919 Thyroid hormone signaling pathway
    112205915
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112205915
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112205915
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112205915
   05231 Choline metabolism in cancer
    112205915
  09162 Cancer: specific types
   05215 Prostate cancer
    112205915
   05213 Endometrial cancer
    112205915
   05223 Non-small cell lung cancer
    112205915
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112205915
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112205915
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112205915
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112205915
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   112205915
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    112205915
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH YukC RIO1
Other DBs
NCBI-GeneID: 112205915
NCBI-ProteinID: XP_024205820
LinkDB
Position
16
AA seq 417 aa
MNWSKEEPCQQTSTLYMLFITRLRSIEENSSSVPHYDAMPIQSSMVLCSCPSPSMVRSQT
ESSTAPGIPGGSRQGPAMNNTASEPQPGAGSLQHXPPPQPQKKRPEDFKFGKILGEGSFS
TVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEK
LYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLN
EDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQ
LVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYG
PLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNLWRIFGPQEDFDVTNY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaactggtcaaaggaagagccatgccagcaaacgtctacactgtacatgctttttatt
acaagactacggagcattgaggaaaattcatcatctgtcccccactatgacgccatgccc
atccagtccagcatggtgttatgttcctgcccatccccatcaatggtgaggtcccagact
gagtccagcacagcccctggcattcctggtggcagcaggcagggccccgccatgaacaac
accgcatctgagcctcagcccggcgccggctccctgcagcacnncccgccaccgcagcct
cagaagaagcggcctgaggacttcaagtttgggaaaattcttggggaaggctctttttcc
acggttgtcctggctcgagaactggcaacctccagagaatatgcgattaaaattctggag
aagcgacatatcataaaagagaacaaggtcccgtatgtaaccagagagcgggatgtcatg
tcgcgcctggatcaccccttctttgttaagctttacttcacatttcaggacgacgagaag
ctgtatttcggccttagttatgccaaaaatggagaactacttaaatatattcgcaaaatc
ggttcattcgatgagacctgtacccgattttacacggctgagattgtgtctgctttagag
tacttgcacggcaagggcatcattcacagggaccttaaaccggaaaacattttgttaaat
gaagatatgcacatccagatcacagattttggaacagcaaaagtcttatccccagagagc
aaacaagccagggccaactcattcgtgggaacagcgcagtacgtttctccagagctgctc
acggagaagtccgcctgtaagagttcagacctttgggctcttggatgcataatataccag
cttgtggcaggactcccaccattccgagctggaaacgagtatcttatatttcagaagatc
attaagttggaatatgactttccagaaaaattcttccctaaggcaagagacctcgtggag
aaacttttggttttagatgccacaaagcggttaggctgtgaggaaatggaagggtacgga
cctcttaaagcacacccgttcttcgagtccgtcacgtgggagaacctgcaccagcagacg
cctccgaagctcaccgcttacctgccggctatgtcggaagacgacgaggactgctatggc
aatctgtggcgtatctttggcccacaagaggactttgatgtcaccaattactaa

KEGG   Pan troglodytes (chimpanzee): 467875
Entry
467875            CDS       T01005                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01524  Platinum drug resistance
ptr03320  PPAR signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04510  Focal adhesion
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04931  Insulin resistance
ptr04960  Aldosterone-regulated sodium reabsorption
ptr05145  Toxoplasmosis
ptr05205  Proteoglycans in cancer
ptr05213  Endometrial cancer
ptr05215  Prostate cancer
ptr05223  Non-small cell lung cancer
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    467875 (PDPK1)
   04071 Sphingolipid signaling pathway
    467875 (PDPK1)
   04151 PI3K-Akt signaling pathway
    467875 (PDPK1)
   04152 AMPK signaling pathway
    467875 (PDPK1)
   04150 mTOR signaling pathway
    467875 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    467875 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    467875 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    467875 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    467875 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    467875 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    467875 (PDPK1)
   03320 PPAR signaling pathway
    467875 (PDPK1)
   04919 Thyroid hormone signaling pathway
    467875 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    467875 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    467875 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    467875 (PDPK1)
   05231 Choline metabolism in cancer
    467875 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    467875 (PDPK1)
   05213 Endometrial cancer
    467875 (PDPK1)
   05223 Non-small cell lung cancer
    467875 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    467875 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    467875 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    467875 (PDPK1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     467875 (PDPK1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   467875 (PDPK1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    467875 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 467875
NCBI-ProteinID: XP_024205812
Ensembl: ENSPTRG00000007655
VGNC: 13762
LinkDB
Position
16
AA seq 556 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDTGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDGAVQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgtgcccatccagtccagcgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccagcacgccccctggc
attcctggtggcagcaggcagggccccgccatggacggcactgcagccgagcctcggccc
ggcgccggctccctgcagcatgcccagcctccgccgcagcctcggaagaagcggcctgag
gacttcaagtttgggaaaattcttggggaaggctctttttccacggttgtcctggctcga
gaactggcaacctccagagaatatgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaggtcccgtatgtaaccagagagcgggatgtcatgtcgcgcctggatcacccc
ttctttgttaagctttacttcacatttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaatggagaactacttaaatatattcgcaaaatcggttcattcgatgagacc
tgtacccgattttacacggctgagattgtgtctgctttagagtacttgcacggcaagggc
atcattcacagggaccttaaaccggaaaacattttgttaaatgaagatatgcacatccag
atcacagattttggaacagcaaaagtcttatccccagagagcaaacaagccagggccaac
tcattcgtgggaacagcgcagtacgtttctccagagctgctcacggagaagtccgcctgt
aagagttcagacctttgggctcttggatgcataatataccagcttgtggcaggactccca
ccattccgagctggaaacgagtatcttatatttcagaagatcattaagttggaatatgac
tttccagaaaaattcttccctaaggcaagagacctcgtggagaaacttttggttttagat
gccacaaagcggttaggctgtgaggaaatggaagggtacggacctcttaaagcacacccg
ttcttcgagtccgtcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccggctatgtcggaagacgacgaggactgctatggcaattatgacaatctcctg
agccagtttggctgcatgcaggtgtcttcgtcctcgtcctcacactccctgtcagcctcc
gacacgggcctgccccagaggtcaggcagcaacatagagcagtacattcacgatctggac
tcgaactcctttgaactggacttacagttttccgaagatgagaagaggttgttgttggag
aagcaggctggcggaaacccttggcaccagtttgtagaaaataatttaatactaaagatg
ggcccagtggataagcggaagggtttatttgcaagacgacgacagctgttgctcacagaa
ggaccacatttatattatgtggatcctgtcaacaaagtcctgaaaggtgaaattccttgg
tcacaagaacttcgaccagaggccaagaattttaaaactttctttgtccacacgcctaac
aggacgtattatttgatggaccccagcgggaatgcacacaagtggtgcaggaagatccag
gaggtttggaggcagcgataccagagccacccggacggggctgtgcagtga

DBGET integrated database retrieval system