KEGG   Pan troglodytes (chimpanzee): 449517
Entry
449517            CDS       T01005                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma precursor
  KO
K04687  interferon gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03050  Proteasome
ptr04060  Cytokine-cytokine receptor interaction
ptr04066  HIF-1 signaling pathway
ptr04217  Necroptosis
ptr04350  TGF-beta signaling pathway
ptr04380  Osteoclast differentiation
ptr04612  Antigen processing and presentation
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04940  Type I diabetes mellitus
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05143  African trypanosomiasis
ptr05144  Malaria
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05164  Influenza A
ptr05168  Herpes simplex virus 1 infection
ptr05200  Pathways in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05321  Inflammatory bowel disease
ptr05322  Systemic lupus erythematosus
ptr05323  Rheumatoid arthritis
ptr05330  Allograft rejection
ptr05332  Graft-versus-host disease
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    449517 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    449517 (IFNG)
   04630 JAK-STAT signaling pathway
    449517 (IFNG)
   04066 HIF-1 signaling pathway
    449517 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    449517 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    449517 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    449517 (IFNG)
   04612 Antigen processing and presentation
    449517 (IFNG)
   04660 T cell receptor signaling pathway
    449517 (IFNG)
   04658 Th1 and Th2 cell differentiation
    449517 (IFNG)
   04659 Th17 cell differentiation
    449517 (IFNG)
   04657 IL-17 signaling pathway
    449517 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    449517 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    449517 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    449517 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    449517 (IFNG)
   05323 Rheumatoid arthritis
    449517 (IFNG)
   05321 Inflammatory bowel disease
    449517 (IFNG)
   05330 Allograft rejection
    449517 (IFNG)
   05332 Graft-versus-host disease
    449517 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    449517 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    449517 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    449517 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    449517 (IFNG)
   05164 Influenza A
    449517 (IFNG)
   05168 Herpes simplex virus 1 infection
    449517 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    449517 (IFNG)
   05144 Malaria
    449517 (IFNG)
   05145 Toxoplasmosis
    449517 (IFNG)
   05140 Leishmaniasis
    449517 (IFNG)
   05142 Chagas disease
    449517 (IFNG)
   05143 African trypanosomiasis
    449517 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ptr03051]
    449517 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    449517 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    449517 (IFNG)
Proteasome [BR:ptr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    449517 (IFNG)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interferons
   449517 (IFNG)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Cytokines
   449517 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 Tup_N
Other DBs
NCBI-GeneID: 449517
NCBI-ProteinID: NP_001180594
Ensembl: ENSPTRG00000005193
UniProt: Q9TTB0 H2Q6F3 A0A6D2XNN1
LinkDB
Position
12
AA seq 166 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAVKTGKRKRSQMLFRGRRASQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtcattcagatgtagcagataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat
tattcggtaactgacttgaatgtccaacgcaaggcaatacatgaactcatccaagtgatg
gctgaactgtcgccagcagttaaaacggggaagcgaaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system