KEGG   Pan troglodytes (chimpanzee): 449564
Entry
449564            CDS       T01005                                 

Gene name
IL13
Definition
(RefSeq) interleukin-13 precursor
  KO
K05435  interleukin 13
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04630  JAK-STAT signaling pathway
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04664  Fc epsilon RI signaling pathway
ptr05200  Pathways in cancer
ptr05310  Asthma
ptr05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    449564 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    449564 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    449564 (IL13)
   04657 IL-17 signaling pathway
    449564 (IL13)
   04664 Fc epsilon RI signaling pathway
    449564 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    449564 (IL13)
  09163 Immune disease
   05310 Asthma
    449564 (IL13)
   05321 Inflammatory bowel disease
    449564 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    449564 (IL13)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   449564 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 449564
NCBI-ProteinID: NP_001008992
Ensembl: ENSPTRG00000017219
VGNC: 4042
UniProt: P61126 A0A2J8LS10
LinkDB
Position
5
AA seq 132 aa
MALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA
GVYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLL
HLKKLFREGRFN
NT seq 399 nt   +upstreamnt  +downstreamnt
atggcacttttgttgaccacggtcattgctctcacttgccttggcggctttgcctcccca
ggccctgtgcctccctctacagccctcagggagctcattgaggagctggtcaacatcacc
cagaaccagaaggctccgctctgcaatggcagcatggtatggagcatcaacctgacagct
ggcgtgtactgtgcagccctggaatccctgatcaacgtgtcaggctgcagtgccatcgag
aagacccagaggatgctgagcggattctgcccgcacaaggtctcagctgggcagttttcc
agcttgcatgtccgagacaccaaaatcgaggtggcccagtttgtaaaggacctgctctta
catttaaagaaactttttcgcgagggacggttcaactga

DBGET integrated database retrieval system