Pan troglodytes (chimpanzee): 449564 Help Entry 449564            CDS       T01005                                  Gene name IL13 Definition (RefSeq) interleukin-13 precursor   KO K05435   interleukin 13 Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr04060   Cytokine-cytokine receptor interaction ptr04630   JAK-STAT signaling pathway ptr04657   IL-17 signaling pathway ptr04658   Th1 and Th2 cell differentiation ptr04664   Fc epsilon RI signaling pathway ptr05200   Pathways in cancer ptr05310   Asthma ptr05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     449564 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     449564 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     449564 (IL13)    04657 IL-17 signaling pathway     449564 (IL13)    04664 Fc epsilon RI signaling pathway     449564 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     449564 (IL13)   09163 Immune disease    05310 Asthma     449564 (IL13)    05321 Inflammatory bowel disease     449564 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ptr04052]     449564 (IL13) Cytokines and growth factors [BR:ptr04052]  Cytokines   Interleukins    449564 (IL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  449564 NCBI-ProteinID:  NP_001008992 Ensembl:  ENSPTRG00000017219 VGNC:  4042 UniProt:  P61126 A0A2J8LS10 LinkDB All DBs Position 5 AA seq 132 aa AA seqDB search MALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GVYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLL HLKKLFREGRFN NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggcacttttgttgaccacggtcattgctctcacttgccttggcggctttgcctcccca ggccctgtgcctccctctacagccctcagggagctcattgaggagctggtcaacatcacc cagaaccagaaggctccgctctgcaatggcagcatggtatggagcatcaacctgacagct ggcgtgtactgtgcagccctggaatccctgatcaacgtgtcaggctgcagtgccatcgag aagacccagaggatgctgagcggattctgcccgcacaaggtctcagctgggcagttttcc agcttgcatgtccgagacaccaaaatcgaggtggcccagtttgtaaaggacctgctctta catttaaagaaactttttcgcgagggacggttcaactga

DBGET integrated database retrieval system