KEGG   Pan troglodytes (chimpanzee): 449567Help
Entry
449567            CDS       T01005                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04614  Renin-angiotensin system
ptr04924  Renin secretion
ptr05142  Chagas disease (American trypanosomiasis)
ptr05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    449567 (ACE)
   04614 Renin-angiotensin system
    449567 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    449567 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    449567 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    449567 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    449567 (ACE)
   04090 CD Molecules [BR:ptr04090]
    449567 (ACE)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     449567 (ACE)
Peptidases [BR:ptr01002]
 Metallo Peptidases
  Family M2
   449567 (ACE)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   449567 (ACE)
CD molecules [BR:ptr04090]
 Proteins
  449567 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 449567
NCBI-ProteinID: NP_001008995
VGNC: 51632
UniProt: H2QZH0
LinkDB All DBs
Position
17
AA seq 1306 aa AA seqDB search
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPVWQNFTDPQLRRI
IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR
SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL
EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEAI
GDVLALSVSTPAHLHKIGLLDNVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPNSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS
QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNQLQNTTIKRI
IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLTNVMATSRKY
EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD
VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS
ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE
ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFDSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggctgctgctgccgctgccgctgctgttg
ctgctgccgccgcagcccgccctggcgctggaccccgggctgcagcccggcaacttttct
gctgacgaggccggggcgcagctcttcgcgcagagctacaactccagcgccgaacaggtg
ctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgcggagaatgca
aggcgccaggaggaagcagccctgctcagccaggagtttgcggaggcctggggccagaag
gccaaggagctgtatgaaccggtctggcagaacttcacggacccgcagctgcgcaggatc
atcggagctgtgcgcaccctgggctctgccaatctgcccctggctaagcggcagcagtac
aacgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctccccaac
aagactgccacctgctggtccctggacccagatctcacgaacatcctggcttcctcgcga
agctacgccatgctcctgtttgcctgggagggctggcacaacgctgcgggcatcccgctg
aaaccgctgtacgaggatttcactgccctcagcaatgaagcctacaagcaggacggcttc
acagacacgggggcctactggcgctcctggtacaactcccccaccttcgaggacgatctg
gaacacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgccgc
gcgctgcatcgccgatacggggacagatacatcaacctcaggggacccatccctgctcat
ctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcctttc
ccagacaagcccaacctcgatgtcaccagtactatgctgcagcagggctggaacgccacg
cacatgttccgggtggcagaggagttcttcacctccctggagctctccccgatgcctccc
gagttctgggaagggtcgatgctggagaagccggctgacgggcgggaagtggtgtgccac
gcctcggcttgggacttctacaacaggaaagacttcaggatcaagcagtgcacacgggtc
acaatggaccagctctccacagtgcaccatgagatgggccatatacagtactacctgcag
tacaaggatctgcccgtctccctgcgtgggggggccaaccccggcttccatgaggccatt
ggggacgtgctggcgctctcggtctccactcctgcacatctgcacaaaatcggcctgctg
gacaatgtcaccaatgacacggaaagtgacatcaattacttgctaaaaatggcactggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtctttagt
gggcgtacccccaattcccgctacaacttcgactggtggtatcttcgaaccaagtatcag
ggcatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagtttcat
gttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccagttc
catgaagccctgtgcaaggaggcaggctatgagggcccactgcaccagtgtgacatctac
cagtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctctaggccc
tggcaggaggtgctgaaggacatggtcggcttagatgccctggatgcccagccgctgctc
aagtacttccagccagtcacccagtggctgcaggagcagaaccagcagaacggcgaggtc
ctgggctggcccgagtaccagtggcacccgccgttacctgacaactacccggagggcata
gacctggtgactgatgaggctgaggccagcaagtttgtggaggaatatgaccggacatcc
caggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacatcaccaca
gagaccagcaagattctgctgcagaagaacatgcagatagccaaccacaccctgaaatac
ggcacccaggccaggaggtttgatgtgaaccagttgcagaacaccactatcaagcggatc
ataaagaaggttcaggacctagaacgggcagcgctgcctgcccaggagctggaggagtac
aacaagatcctgttggatatggaaaccacctacagcgtggccactgtgtgccacacaaat
ggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacatcccggaaatat
gaagacttgttatgggcatgggagggctggcgagacaaggcggggagagccatcctccag
ttttacccgaaatacgtggaactcatcaaccaggctgcccggctcaatggctatgtagac
gcaggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggagcgg
ctcttccaggagctgcagccgctctacctgaacctgcatgcctacgtgcgccgggccctg
caccgtcactatggggcccagcacatcaacctggaggggcccattcctgctcacctgctg
gggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttcccttca
gccccctcgatggacaccacagaggctatgctaaagcagggctggacacccaggaggatg
tttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgagttc
tggaacaagtcgatgctggagaagccaaccgacgggcgggaggtggtctgccacgcctcg
gcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaacttg
gaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtacaaa
gacttacctgtggccttgagggagggtgccaaccccggcttccatgaggccattggggac
gtgctagccctctcagtgtctacgcccaagcacctgcacagtctcaacctgctgagcagt
gagggtggcagcgacgagcatgacatcaactttctgatgaagatggcccttgacaagatc
gcctttatccccttcagctacctcgtcgatcagtggcgctggagggtatttgatggaagc
atcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggcctc
tgccccccagtgcccaggactcaaggtgactttgacccaggggccaagttccacattcct
tctagcgtgccttacatcaggtacttcgtcagcttcatcatccagttccagttccatgag
gcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccagtcc
aaggaggccgggcagcgcctggcgaccgccatgaagctgggcttcagtaggccgtggccg
gaagccatgcagctgatcacgggccagcccaacatgagcgcctcggccatgttgagctac
ttcaagccgctgctggactggctccgcacggagaacgagctgcatggggagaagctgggc
tggccgcagtacaactggacgccgaactccgctcgctcagaagggccccttccagacagc
ggccgcgtcagcttcctgggcctggacctggatgcgcagcaggcccgcgtgggccagtgg
ctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcggctc
ttcagcatccgccaccgcagcctccaccggcactcccacgggccccagtttgactccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system