KEGG   Pan troglodytes (chimpanzee): 449634Help
Entry
449634            CDS       T01005                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04068  FoxO signaling pathway
ptr04146  Peroxisome
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    449634 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    449634 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    449634 (SOD2)
   04213 Longevity regulating pathway - multiple species
    449634 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    449634 (SOD2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     449634 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 449634
NCBI-ProteinID: NP_001009022
Ensembl: ENSPTRG00000018757
VGNC: 52105
UniProt: Q8HXP7
LinkDB All DBs
Position
6
AA seq 199 aa AA seqDB search
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIA
LQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQ
GSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA
IWNVINWENVTERYMACKK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacagcctccccgacctgccctacgactacggcgccctggaacctcacatcaac
gcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaataacctgaac
gtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcccagatagct
cttcagcctgcactgaagttcaatggtggtggtcatatcaatcatagcattttctggaca
aacctcagccctaacggtggtggagaacccaaaggggagttgctggaagccatcaaacgt
gactttggttcctttgacaagtttaaggagaagctgacggctgcatctgttggtgtccaa
ggctcaggttggggttggcttggtttcaataaggaacggggacacttacaaattgctgct
tgtccaaatcaggatccactgcaaggaacaacaggccttattccactgctggggattgat
gtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattatctaaaagct
atttggaatgtaatcaactgggagaatgtaactgaaagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system