KEGG   Pan troglodytes (chimpanzee): 450124
Entry
450124            CDS       T01005                                 

Gene name
CD4
Definition
(RefSeq) T-cell surface glycoprotein CD4 precursor
  KO
K06454  T-cell surface glycoprotein CD4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04514  Cell adhesion molecules
ptr04612  Antigen processing and presentation
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr05135  Yersinia infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    450124 (CD4)
   04514 Cell adhesion molecules
    450124 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    450124 (CD4)
   04612 Antigen processing and presentation
    450124 (CD4)
   04660 T cell receptor signaling pathway
    450124 (CD4)
   04658 Th1 and Th2 cell differentiation
    450124 (CD4)
   04659 Th17 cell differentiation
    450124 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    450124 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    450124 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    450124 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    450124 (CD4)
   05170 Human immunodeficiency virus 1 infection
    450124 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptr04090]
    450124 (CD4)
CD molecules [BR:ptr04090]
 Proteins
  450124 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set I-set Ig_3 Ig_2 Receptor_2B4 Tcell_CD4_C Ig_5 Ig_6 Herpes_gE P_proprotein
Other DBs
NCBI-GeneID: 450124
NCBI-ProteinID: NP_001009043
Ensembl: ENSPTRG00000004590
VGNC: 5330
UniProt: P16004 K7AM69 A0A663D762
LinkDB
Position
12
AA seq 458 aa
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQTK
ILGNQGSFLTKGPSKLNDRVDSRRSLWDQGNFTLIIKNLKIEDSDTYICEVGDQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG
TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAQRMSQIKRLLSEKKTCQCPHRFQKTCSPI
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaccggggagtcccttttaggcacttgcttctggtgctgcaactggcactcctccca
gcagccactcagggaaagaaagtggtgctgggcaagaaaggggacacagtggaactgacc
tgtacagcttcccagaagaagagcatacaattccactggaaaaactccaaccagacaaag
attctgggaaatcagggctccttcttaactaaaggtccatccaagctgaatgatcgcgtt
gactcaagaagaagcctttgggaccaaggaaactttaccctgatcatcaagaatcttaag
atagaagactcagatacttacatctgtgaagtgggggaccagaaggaggaggtgcaattg
ctagtgttcggattgactgccaactctgacacccacctgcttcaggggcagagcctgacc
ctgaccttggagagcccccctggtagtagcccctcagtgcaatgtaggagtccaaggggt
aaaaacatacagggggggaagaccctctccgtgtctcagctggagctccaggatagtggc
acctggacatgcactgtcttgcagaaccagaagaaagtggagttcaaaatagacatcgtg
gtgctagctttccagaaggcctccagcatagtctataagaaagagggggaacaggtggag
ttctccttcccactcgcctttacagttgaaaagctgacgggcagtggcgagctgtggtgg
caggcggagagggcttcctcctccaagtcttggatcacctttgacctgaagaacaaggaa
gtgtctgtaaaacgggttacccaggaccctaagctccagatgggcaagaagctcccgctc
cacctcaccctgccccaggccttgcctcagtatgctggctctggaaacctcaccctggcc
cttgaagcgaaaacaggaaagttgcatcaggaagtgaacctcgtggtgatgagagccact
cagctccagaaaaatttgacctgtgaggtgtggggacccacctcccctaagctgatgctg
agcttgaaactggagaacaaggaggcaaaggtctcgaagcgggagaaggcggtgtgggtg
ctgaaccctgaggcggggatgtggcagtgtctgctgagtgactcgggacaggtcctgctg
gaatccaacatcaaggttctgcccacatggtccaccccggtgcagccaatggccctgatt
gtgctggggggcgtcgccggcctcctgcttttcattgggctaggcatcttcttctgtgtc
aggtgccggcaccgaaggcgccaagcacagcggatgtctcagatcaagagactcctcagt
gagaagaagacctgccagtgccctcaccggtttcagaagacatgtagccccatttga

DBGET integrated database retrieval system