KEGG   Pan troglodytes (chimpanzee): 450176
Entry
450176            CDS       T01005                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3 isoform X1
  KO
K17448  SHC-transforming protein 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05034  Alcoholism
ptr05100  Bacterial invasion of epithelial cells
ptr05214  Glioma
ptr05220  Chronic myeloid leukemia
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    450176 (SHC3)
   04014 Ras signaling pathway
    450176 (SHC3)
   04072 Phospholipase D signaling pathway
    450176 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    450176 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    450176 (SHC3)
   04062 Chemokine signaling pathway
    450176 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    450176 (SHC3)
   04915 Estrogen signaling pathway
    450176 (SHC3)
   04917 Prolactin signaling pathway
    450176 (SHC3)
   04926 Relaxin signaling pathway
    450176 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    450176 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    450176 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    450176 (SHC3)
   05226 Gastric cancer
    450176 (SHC3)
   05214 Glioma
    450176 (SHC3)
   05220 Chronic myeloid leukemia
    450176 (SHC3)
   05224 Breast cancer
    450176 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    450176 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    450176 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    450176 (SHC3)
   01522 Endocrine resistance
    450176 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 450176
NCBI-ProteinID: XP_009455125
Ensembl: ENSPTRG00000021091
VGNC: 10418
UniProt: A0A2I3RG08
LinkDB
Position
9
AA seq 598 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDG
PGSLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPA
MSAARKGRPGDEPLPRPPRGAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQI
TREAISRVCEAVPGAKGAFKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDTRL
KPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGERKGSSDIYSTPEGKLHVA
PTGEAPTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVE
CISPVSPRAPDAKMLEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGM
HNGQAKHLLLVDPEGTIRTKDRVFDSISHLINHHLESSLPIVSAGSELCLQQPVERKQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgagcggcggcggaggcaaggtttcggcggcgcgcgcgacc
ccggcggcggctccctacttggtgtccggcgaggcgctgcgcaaggcgcccgacgatggg
cccggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggc
ctccgcggcctgtcgtcggccgcccgggagcgggcgggcgcgcggctctcgggcagctgc
agcgcgcccagcctggccgccccggacggcagcgcgccctcggcgccccgcgccccggcc
atgagcgccgccaggaagggccggcccggcgacgagccgctgcccaggccccctcggggg
gcgccgcacgccagcgaccaggtgctggggcccggagtcacctacgtggtcaagtacttg
gggtgcattgaagttctgcgctcaatgaggtctcttgacttcagtacaagaacacaaatt
accagggaagccatcagccgtgtctgtgaagctgtgcctggtgccaagggagccttcaag
aagagaaagcctccgagcaaaatgctgtccagcatcttgggaaagagcaacctccagttt
gcaggaatgagcatctctctgaccatctccacggccagtctgaacctgcgaactccagac
tccaaacagatcatagcgaatcaccacatgcggtccatctccttcgcctctgggggagac
ccggacacaactgactatgttgcatatgtggctaaggaccctgttaatcgcagagcttgt
cacattttggaatgctgtgatgggctggcccaggatgtcatcggctccatcggacaagcc
tttgagctccggtttaagcaatatttacagtgtcctaccaagattcccgctctccatgat
cgaatgcagagtctggatgagccatggacggaagaggagggagatggctcagaccaccca
tactacaacagcatcccaagcaagatgcctcctccagggggctttcttgatactagactg
aaacccagaccccatgctcctgacacagcccagtttgcaggaaaagagcagacttattac
cagggaagacacttaggagacacttttggcgaagactggcagcaaacacctttaaggcaa
ggtgagaggaaagggtcctcggacatctacagcacgccagaagggaaactgcacgtggcc
cccacgggagaagcacccacctacgtcaacactcagcagatcccaccacaggcctggccg
gctgcggtcagcagtgctgagagcagcccgaggaaagacctctttgacatgaaacctttt
gaagatgctctcaagaaccagcccttggggcctgtgttaagcaaggcagcctccgtggag
tgcatcagccctgtgtcacctagagccccagatgccaagatgctggaggaactgcaagcc
gagacttggtaccaaggagagatgagcaggaaggaggcagaggggctgctggagaaagac
ggagacttcctggtcaggaagagcaccaccaacccgggctcctttgtcctcacgggcatg
cacaatggccaggccaagcacctgctgctcgtggacccagaaggcacgatccggacaaag
gacagagtctttgacagtatcagccacctcatcaaccaccacctagaaagcagcctgccc
attgtctctgcagggagtgagctgtgtctccagcagccagtggagaggaagcagtga

KEGG   Pan troglodytes (chimpanzee): 453414
Entry
453414            CDS       T01005                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05034  Alcoholism
ptr05100  Bacterial invasion of epithelial cells
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05220  Chronic myeloid leukemia
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    453414 (SHC4)
   04014 Ras signaling pathway
    453414 (SHC4)
   04072 Phospholipase D signaling pathway
    453414 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    453414 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    453414 (SHC4)
   04062 Chemokine signaling pathway
    453414 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    453414 (SHC4)
   04915 Estrogen signaling pathway
    453414 (SHC4)
   04917 Prolactin signaling pathway
    453414 (SHC4)
   04926 Relaxin signaling pathway
    453414 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    453414 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    453414 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    453414 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    453414 (SHC4)
   05226 Gastric cancer
    453414 (SHC4)
   05214 Glioma
    453414 (SHC4)
   05220 Chronic myeloid leukemia
    453414 (SHC4)
   05224 Breast cancer
    453414 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    453414 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    453414 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    453414 (SHC4)
   01522 Endocrine resistance
    453414 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 453414
NCBI-ProteinID: XP_016783669
Ensembl: ENSPTRG00000007048
VGNC: 10419
UniProt: H2Q9E1 A0A6D2XKC5
LinkDB
Position
15
AA seq 630 aa
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSPQPPH
PALPPHLPTEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESRDPGSSGPSSPETSLSRSGTAPPPQQDLVGHRATALTPDSCPLPGPGEPTLRSRQDRH
FLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
HIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQMAYCPIQCEKLCYLPGNSKC
SSVYENCLEQSRAIGNVHPRGVQSQRDTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGN
QSSAQPLGSPWHCRKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPALLHSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggccaggacagcctggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtcgatcacgtcc
ttggacgaaggtagctccggaggctcggtcgggaacaagggctcgccgcagcctccccac
cccgccctgccacctcacctgccgactgaagatgccaccttgccgtcgcaggagagcccc
accccactgtgcaccttgatcccccgcatggcaagcatgaagctggccaacccggccact
ttgctgagtctgaaaaacttttgcctgggtaccaaagaggtgcctcggctgaagctccag
gaaagccgggacccaggttccagcggcccctcttccccagaaaccagtttaagtaggtcc
gggactgcacctccaccgcagcaggacctggtgggacacagggcaaccgccctaacccct
gattcgtgcccgcttcctggccctggggagccaacacttaggagcaggcaggacaggcac
tttctacagcacctgttggggatgggcatgaactactgtgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgagatcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcaaatggagccattaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcaggaatg
aatataaaactgaccatctcaacatgcagtctcacattgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgtcacatattg
gaatgccacaatggaatggcccaagacgtcataagtaccatagggcaggcttttgaactc
cggtttaaacagtacttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
catattgatagccatgccgaggagagagaagatcatgaatattacaatgaaattccaggg
aagcagccaccagtaggtggtgtttcagatatgcggatcaaagttcaagccacggaacaa
atggcttactgccccatacagtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggcaataggtaatgtccatccaaga
ggggtgcagtcccagcgagatacctcattattgaagcacacgtgccgagtggatctcttc
gatgacccctgctacattaatacacaggctcttcaaagtacacctggctctgctggaaat
caaagttcagcccaaccactggggagcccatggcactgcagaaaggcaccagaaactgtt
cagccgggtgccacagcccagcctgccagctcacattctttgccacacattaagcagcag
ctgtggagcgaagaatgctatcatggcaagctgagcaggaaggcggcagagagcctcttg
gtaaaggatggggactttttggttcgagagagtgcaacatcccctggccaatatgtgctg
agtggactacagggaggccaagcaaaacatcttctcctggtggatcctgaaggcaaggtg
aggaccaaggatcatgtatttgataatgtcggccaccttatcagataccatatggataac
agtttgccaatcatctcctctggaagcgaagtaagccttaaacaaccagtgagaaaagat
aataatccagcacttttgcattccaacaaatga

KEGG   Pan troglodytes (chimpanzee): 457351
Entry
457351            CDS       T01005                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X7
  KO
K06279  SHC-transforming protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05034  Alcoholism
ptr05100  Bacterial invasion of epithelial cells
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05220  Chronic myeloid leukemia
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    457351 (SHC1)
   04014 Ras signaling pathway
    457351 (SHC1)
   04072 Phospholipase D signaling pathway
    457351 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    457351 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    457351 (SHC1)
   04062 Chemokine signaling pathway
    457351 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    457351 (SHC1)
   04915 Estrogen signaling pathway
    457351 (SHC1)
   04917 Prolactin signaling pathway
    457351 (SHC1)
   04926 Relaxin signaling pathway
    457351 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    457351 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    457351 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    457351 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    457351 (SHC1)
   05226 Gastric cancer
    457351 (SHC1)
   05214 Glioma
    457351 (SHC1)
   05220 Chronic myeloid leukemia
    457351 (SHC1)
   05224 Breast cancer
    457351 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    457351 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    457351 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    457351 (SHC1)
   01522 Endocrine resistance
    457351 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 457351
NCBI-ProteinID: XP_003308463
Ensembl: ENSPTRG00000001397
VGNC: 10417
UniProt: A0A2J8Q362
LinkDB
Position
1
AA seq 473 aa
MNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCV
EVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGM
PITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHIL
ECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY
NDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQM
PPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAVNGSVPRDLFDMKPFEDALRV
PPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQP
KHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaacaagctgagtggaggcggcgggcgcaggactcgggtggaagggggccagcttggg
ggcgaggagtggacccgccacgggagctttgtcaataagcccacgcggggctggctgcat
cccaacgacaaagtcatgggacccggggtttcctacttggttcggtacatgggctgtgtg
gaggtcctccagtcaatgcgtgccctggacttcaacacccggactcaggtcaccagggag
gccatcagtctggtgtgtgaggctgtgccaggtgctaagggggcgacaaggaggagaaag
ccctgtagccgcccgctcagctctatcctggggaggagtaacctgaaatttgctggaatg
ccaatcactctcaccgtctccaccagcagcctcaacctcatggccgcagactgcaaacag
atcatcgccaaccaccacatgcaatctatctcatttgcatccggcggggatccggacaca
gccgagtatgtcgcctatgttgccaaagaccctgtgaatcagagagcctgccacattctg
gagtgtcccgaagggcttgcccaggatgtcatcagcaccattggccaggccttcgagttg
cgcttcaaacaatacctcaggaacccacccaaactggtcacccctcatgacaggatggct
ggctttgatggctcagcatgggatgaggaggaggaagagccacctgaccatcagtactat
aatgacttcccggggaaggaaccccccttggggggggtggtagacatgaggcttcgggaa
ggagccgctccaggggctgctcgacccactgcacccaatgcccagacccccagccacttg
ggagctacactgcctgtaggacagcctgttgggggagatccagaagtccgcaaacagatg
ccacctccaccaccctgtccaggcagagagctttttgatgatccctcctatgtcaacgtc
cagaacctagacaaggcccggcaagcagtgggtggtgctgggccccccaatcctgctgtc
aatggcagtgtaccccgggacctgtttgacatgaagcccttcgaagatgctcttcgggtg
cctccacctccccagtcggtgtccatggctgagcagctccgaggggagccctggttccat
gggaagctgagccggcgggaggctgaggcactgctgcagctcaatggggacttcctggtg
cgggagagcacgaccacacctggccagtatgtgctcactggcttgcagagtgggcagcct
aagcatttgctactggtggaccctgagggtgtggttcggactaaggatcaccgctttgaa
agtgtcagtcaccttatcagctaccacatggacaatcacttgcccatcatctctgcgggc
agcgaactgtgtctacagcaacctgtggagcggaaactgtga

KEGG   Pan troglodytes (chimpanzee): 749831
Entry
749831            CDS       T01005                                 

Gene name
SHC2
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04370  VEGF signaling pathway
ptr04510  Focal adhesion
ptr04650  Natural killer cell mediated cytotoxicity
ptr04722  Neurotrophin signaling pathway
ptr04910  Insulin signaling pathway
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05034  Alcoholism
ptr05100  Bacterial invasion of epithelial cells
ptr05214  Glioma
ptr05220  Chronic myeloid leukemia
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    749831 (SHC2)
   04014 Ras signaling pathway
    749831 (SHC2)
   04370 VEGF signaling pathway
    749831 (SHC2)
   04072 Phospholipase D signaling pathway
    749831 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    749831 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    749831 (SHC2)
   04062 Chemokine signaling pathway
    749831 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    749831 (SHC2)
   04915 Estrogen signaling pathway
    749831 (SHC2)
   04917 Prolactin signaling pathway
    749831 (SHC2)
   04926 Relaxin signaling pathway
    749831 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    749831 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    749831 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    749831 (SHC2)
   05226 Gastric cancer
    749831 (SHC2)
   05214 Glioma
    749831 (SHC2)
   05220 Chronic myeloid leukemia
    749831 (SHC2)
   05224 Breast cancer
    749831 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    749831 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    749831 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    749831 (SHC2)
   01522 Endocrine resistance
    749831 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 749831
NCBI-ProteinID: XP_024207675
LinkDB
Position
19
AA seq 581 aa
MTQGPGGRAPPAPXPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGAD
PQPEPAGPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGARGAAGSGDAAA
AAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTRE
AINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQV
IANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFELR
FKQYLHSPPKVTLPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALTQ
PCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPGHEEHLYVNTQGLD
APEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEEQ
LRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVV
RTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcgcccccggcgcccnncccccccgagcccgaggcg
cccaccaccttctgcgcgttgctgccccgaatgccgcagtggaagttcgcggccccgggc
ggcttcctgggccgcggcccggcggcggcgcgggcggctggggcctcggggggcgcggac
ccccaacccgagccggcgggcccggggggcgtcccggcgctggcggccgccgtcctgggc
gcctgcgagccccgctgcgccgcgccctgtcccctgcccgcgctcagccgctgtcggggc
gcggggtcgcgggggtcgcggggcgcgcggggggcggcggggtccggggacgccgccgcc
gccgccgagtggatccggaagggcagcttcatccacaaacccgcgcacggctggctacac
cccgacgccagggttctggggcccggggtctcctacgtcgtgcggtacatgggctgcatc
gaggttctccgctccatgcgctccctggactttaacacgcgcacgcaggtgaccagggaa
gccatcaaccggctccatgaggccgtgcctggcgtccggggatcctggaagaaaaaggcc
cccaacaaggccctggcgtccgtcctgggcaagagcaaccttcgctttgccggcatgagc
atctccatccacatctccactgatggcctcagcctctctgtgcctgccacgcgccaggtc
atcgccaaccaccacatgccgtccatctcctttgcgtcaggcggagacacggacatgacg
gattacgtggcctacgtcgccaaggacccgatcaaccagagagcctgccacatcctggag
tgctgtgagggcctggcacagagcatcatcagcaccgtgggccaagctttcgagctgcgc
ttcaagcagtacctgcacagcccacccaaggtgacgctgcccccagaaaggctggcgggg
ccggaggagtcggcctggggggacgaggaggactctttggagcacaattactacaacagc
atcccggggaaggagccgccgctgggcgggctagtggactccaggctggccctgacacag
ccctgcgccctcacggccctcgaccagggcccatctccttctctaagagatgcctgcagc
ctgccatgggacgtggggtccaccggtacagctccaccgggggacggctacgtgcaggcg
gacgcccggggccccccgggccacgaggagcacctgtatgtcaacacccagggtctggac
gcccccgagccggaggacagccccaaaaaggatctgtttgacatgcgaccctttgaggat
gccctgaagttgcatgagtgctcggtggcggcaggcgtcacagcagccccccttcccttg
gaggaccagtggcccagcccccctacccgccgggcccctgtggcccccacggaggaacag
ctgcgtcaggagccctggtaccacggccggatgagccgccgggcggcagagaggatgctc
cgagctgacggggacttccttgtgcgagacagcgtcaccaaccccgggcagtatgtcctc
accggcatgcacgccgggcagcccaagcacctgctgctcgtggaccccgagggcgtggta
cggacgaaggacgtgctgtttgagagcatcagccacctgatcgaccaccacctgcagaac
gggcagcccatcgtggccgccgagagtgagctgcacctgcgtggcgtggtctcacgggag
ccctga

DBGET integrated database retrieval system