KEGG   Pan troglodytes (chimpanzee): 450188
Entry
450188            CDS       T01005                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04114  Oocyte meiosis
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04540  Gap junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04929  GnRH secretion
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05034  Alcoholism
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    450188 (MAP2K1)
   04012 ErbB signaling pathway
    450188 (MAP2K1)
   04014 Ras signaling pathway
    450188 (MAP2K1)
   04015 Rap1 signaling pathway
    450188 (MAP2K1)
   04370 VEGF signaling pathway
    450188 (MAP2K1)
   04371 Apelin signaling pathway
    450188 (MAP2K1)
   04668 TNF signaling pathway
    450188 (MAP2K1)
   04066 HIF-1 signaling pathway
    450188 (MAP2K1)
   04068 FoxO signaling pathway
    450188 (MAP2K1)
   04072 Phospholipase D signaling pathway
    450188 (MAP2K1)
   04071 Sphingolipid signaling pathway
    450188 (MAP2K1)
   04024 cAMP signaling pathway
    450188 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    450188 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    450188 (MAP2K1)
   04150 mTOR signaling pathway
    450188 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    450188 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    450188 (MAP2K1)
   04210 Apoptosis
    450188 (MAP2K1)
   04218 Cellular senescence
    450188 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    450188 (MAP2K1)
   04540 Gap junction
    450188 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    450188 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    450188 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    450188 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    450188 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    450188 (MAP2K1)
   04660 T cell receptor signaling pathway
    450188 (MAP2K1)
   04662 B cell receptor signaling pathway
    450188 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    450188 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    450188 (MAP2K1)
   04062 Chemokine signaling pathway
    450188 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    450188 (MAP2K1)
   04929 GnRH secretion
    450188 (MAP2K1)
   04912 GnRH signaling pathway
    450188 (MAP2K1)
   04915 Estrogen signaling pathway
    450188 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    450188 (MAP2K1)
   04917 Prolactin signaling pathway
    450188 (MAP2K1)
   04921 Oxytocin signaling pathway
    450188 (MAP2K1)
   04926 Relaxin signaling pathway
    450188 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    450188 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    450188 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    450188 (MAP2K1)
   04916 Melanogenesis
    450188 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    450188 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    450188 (MAP2K1)
   04726 Serotonergic synapse
    450188 (MAP2K1)
   04720 Long-term potentiation
    450188 (MAP2K1)
   04730 Long-term depression
    450188 (MAP2K1)
   04722 Neurotrophin signaling pathway
    450188 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    450188 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    450188 (MAP2K1)
   05206 MicroRNAs in cancer
    450188 (MAP2K1)
   05205 Proteoglycans in cancer
    450188 (MAP2K1)
   05230 Central carbon metabolism in cancer
    450188 (MAP2K1)
   05231 Choline metabolism in cancer
    450188 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    450188 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    450188 (MAP2K1)
   05212 Pancreatic cancer
    450188 (MAP2K1)
   05225 Hepatocellular carcinoma
    450188 (MAP2K1)
   05226 Gastric cancer
    450188 (MAP2K1)
   05214 Glioma
    450188 (MAP2K1)
   05216 Thyroid cancer
    450188 (MAP2K1)
   05221 Acute myeloid leukemia
    450188 (MAP2K1)
   05220 Chronic myeloid leukemia
    450188 (MAP2K1)
   05218 Melanoma
    450188 (MAP2K1)
   05211 Renal cell carcinoma
    450188 (MAP2K1)
   05219 Bladder cancer
    450188 (MAP2K1)
   05215 Prostate cancer
    450188 (MAP2K1)
   05213 Endometrial cancer
    450188 (MAP2K1)
   05224 Breast cancer
    450188 (MAP2K1)
   05223 Non-small cell lung cancer
    450188 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    450188 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    450188 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    450188 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    450188 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    450188 (MAP2K1)
   05135 Yersinia infection
    450188 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    450188 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    450188 (MAP2K1)
   05161 Hepatitis B
    450188 (MAP2K1)
   05160 Hepatitis C
    450188 (MAP2K1)
   05164 Influenza A
    450188 (MAP2K1)
   05163 Human cytomegalovirus infection
    450188 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    450188 (MAP2K1)
   05165 Human papillomavirus infection
    450188 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    450188 (MAP2K1)
   01522 Endocrine resistance
    450188 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    450188 (MAP2K1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     450188 (MAP2K1)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   450188 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like Choline_kinase SRC-1 NAD_binding_6
Other DBs
NCBI-GeneID: 450188
NCBI-ProteinID: NP_001009071
Ensembl: ENSPTRG00000007193
VGNC: 7531
UniProt: Q9XT09
LinkDB
Position
15
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVQPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERFQGTHY
SVQSDIWSMGLSPVEMAVGRYPIPSPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctctgcagtt
aacgggaccagctctgcggagaccaacttggaggccttgcagaagaagctggaggagcta
gagcttgatgagcagcagcgaaagcgccttgaggcctttcttacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggggctggcaatggcggt
gtggtgttcaaggtctcccacaagccttctggcctggtcatggccagaaagctaattcat
ctggagatcaaacccgcaatccggaaccagatcataagggagctgcaggttctgcatgag
tgcaactctccgtacatcgtgggcttctatggtgcattctacagcgatggcgagatcagt
atctgcatggagcacatggatggaggttctctggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatatctg
agggagaagcacaagatcatgcacagagatgtccagccctccaacatcctagtcaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagattccaggggactcattac
tctgtgcagtcagacatctggagcatgggactctctccggtagagatggcagttgggagg
tatcccatcccttctccggatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagaccccacccaggccaaggaccccagggaggcctcttagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgag
cctcctccaaaactgcccagtggagtgttcagtctggaatttcaagattttgtgaataaa
tgcctaattaaaaaccccgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcgggttggctctgctccaccatcggg
cttaaccagcccagcacaccaacccatgctgctggcgtctaa

KEGG   Pan troglodytes (chimpanzee): 456390
Entry
456390            CDS       T01005                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr04270  Vascular smooth muscle contraction
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04540  Gap junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    456390 (MAP2K2)
   04012 ErbB signaling pathway
    456390 (MAP2K2)
   04014 Ras signaling pathway
    456390 (MAP2K2)
   04015 Rap1 signaling pathway
    456390 (MAP2K2)
   04370 VEGF signaling pathway
    456390 (MAP2K2)
   04371 Apelin signaling pathway
    456390 (MAP2K2)
   04066 HIF-1 signaling pathway
    456390 (MAP2K2)
   04068 FoxO signaling pathway
    456390 (MAP2K2)
   04072 Phospholipase D signaling pathway
    456390 (MAP2K2)
   04071 Sphingolipid signaling pathway
    456390 (MAP2K2)
   04024 cAMP signaling pathway
    456390 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    456390 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    456390 (MAP2K2)
   04150 mTOR signaling pathway
    456390 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    456390 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    456390 (MAP2K2)
   04218 Cellular senescence
    456390 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    456390 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    456390 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    456390 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    456390 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    456390 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    456390 (MAP2K2)
   04660 T cell receptor signaling pathway
    456390 (MAP2K2)
   04662 B cell receptor signaling pathway
    456390 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    456390 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    456390 (MAP2K2)
   04929 GnRH secretion
    456390 (MAP2K2)
   04912 GnRH signaling pathway
    456390 (MAP2K2)
   04915 Estrogen signaling pathway
    456390 (MAP2K2)
   04917 Prolactin signaling pathway
    456390 (MAP2K2)
   04921 Oxytocin signaling pathway
    456390 (MAP2K2)
   04926 Relaxin signaling pathway
    456390 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    456390 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    456390 (MAP2K2)
   04916 Melanogenesis
    456390 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    456390 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    456390 (MAP2K2)
   04730 Long-term depression
    456390 (MAP2K2)
   04722 Neurotrophin signaling pathway
    456390 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    456390 (MAP2K2)
   05206 MicroRNAs in cancer
    456390 (MAP2K2)
   05205 Proteoglycans in cancer
    456390 (MAP2K2)
   05230 Central carbon metabolism in cancer
    456390 (MAP2K2)
   05231 Choline metabolism in cancer
    456390 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    456390 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    456390 (MAP2K2)
   05225 Hepatocellular carcinoma
    456390 (MAP2K2)
   05226 Gastric cancer
    456390 (MAP2K2)
   05214 Glioma
    456390 (MAP2K2)
   05216 Thyroid cancer
    456390 (MAP2K2)
   05221 Acute myeloid leukemia
    456390 (MAP2K2)
   05220 Chronic myeloid leukemia
    456390 (MAP2K2)
   05218 Melanoma
    456390 (MAP2K2)
   05211 Renal cell carcinoma
    456390 (MAP2K2)
   05219 Bladder cancer
    456390 (MAP2K2)
   05215 Prostate cancer
    456390 (MAP2K2)
   05213 Endometrial cancer
    456390 (MAP2K2)
   05224 Breast cancer
    456390 (MAP2K2)
   05223 Non-small cell lung cancer
    456390 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    456390 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    456390 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    456390 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    456390 (MAP2K2)
   05135 Yersinia infection
    456390 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    456390 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    456390 (MAP2K2)
   05161 Hepatitis B
    456390 (MAP2K2)
   05160 Hepatitis C
    456390 (MAP2K2)
   05164 Influenza A
    456390 (MAP2K2)
   05163 Human cytomegalovirus infection
    456390 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    456390 (MAP2K2)
   05165 Human papillomavirus infection
    456390 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    456390 (MAP2K2)
   01522 Endocrine resistance
    456390 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    456390 (MAP2K2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     456390 (MAP2K2)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   456390 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7
Other DBs
NCBI-GeneID: 456390
NCBI-ProteinID: XP_016790169
Ensembl: ENSPTRG00000010294
VGNC: 7486
LinkDB
Position
19
AA seq 485 aa
MPQALAHTHRGKASEGVRSRNRFASVSAPFPSERRPCAAAQARRLGVGSIAAPDPVIARS
RSAILWPPLPFPCLLDSGCGVSLLRASAAVAARSPQPQRPSATLGPGPQRRPPSAAPTPA
WAAAAAPGSRRRRPLPARPLWAPARGAAAAGPRSPDAGPEEAGAAGAHHQPYHRRGPIPY
QRGRLRLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSL
DQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGV
SGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKEL
EAIFGRPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPN
GVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTP
TRTAV
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgccccaagcgcttgcgcacacgcaccgtggtaaggcaagcgagggcgtccggtcccgg
aaccgcttcgcgtcggtctccgcccctttcccctccgaaaggcggccttgtgctgctgcg
caggcgcggcggctgggggtggggtccatcgcggctcccgatcccgttatcgcgagaagc
cggtccgcgatcttgtggccgcccctccccttcccttgcctcttggactcgggctgcggc
gtcagccttcttcgggcttcggcagcggtggcggctcgctcgcctcagccccagcgcccc
tcggctaccctcggcccaggcccgcagcgccgcccgccctcggccgccccgacgccggcc
tgggccgcggccgcagccccgggctcgcgtaggcgccgaccgctcccggcccgcccccta
tgggccccggctagaggcgccgccgccgccggcccgcggagccccgatgctggcccggag
gaagccggtgctgccggcgctcaccatcaaccctaccatcgccgagggcccatcccctac
cagcgagggcgcctccgactgatccaccttgagatcaagccggccatccggaaccagatc
atccgcgagctgcaggtcctgcacgaatgcaactcgccgtacatcgtgggcttctacggg
gccttctacagtgacggggagatcagcatctgtatggaacacatggatggcggctccctg
gaccaggtgctgaaagaggccaagaggattcccgaggagatcctggggaaagtcagcatc
gcggttctccggggcttggcgtacctccgagagaagcaccagatcatgcaccgagatgtg
aagccctccaacatcctcgtgaactctagaggggagatcaagctgtgtgacttcggggtg
agcggccagctcatcgactccatggccaactccttcgtgggcacgcgctcctacatggct
ccggagcggttgcagggcacacattactcggtgcagtcggacatctggagcatgggcctg
tccctggtggagctggccgtcggaaggtaccccatccccccgcccgacgccaaagagctg
gaggccatctttggccggcccgtggtcgacggggaagaaggagagcctcacagcatctcg
cctcggccgaggccccccgggcgccccgtcagcggtcacgggatggatagccggcccgcc
atggccatctttgaactcctggactatattgtgaacgagccgcctcctaagctgcccaac
ggtgtgttcacccccgacttccaggagtttgtcaataaatgcctcatcaagaacccagcg
gagcgggcggacctgaagatgctcacaaaccacaccttcatcaagcggtccgaggtggaa
gaagtggattttgctggctggttgtgtaaaaccctgcggctgaaccagcccggcacaccc
acgcgcaccgccgtgtga

DBGET integrated database retrieval system