KEGG   Pan troglodytes (chimpanzee): 450200
Entry
450200            CDS       T01005                                 

Gene name
IL1B
Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01523  Antifolate resistance
ptr04010  MAPK signaling pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04064  NF-kappa B signaling pathway
ptr04217  Necroptosis
ptr04380  Osteoclast differentiation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04657  IL-17 signaling pathway
ptr04659  Th17 cell differentiation
ptr04668  TNF signaling pathway
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04940  Type I diabetes mellitus
ptr05010  Alzheimer disease
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05134  Legionellosis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05143  African trypanosomiasis
ptr05144  Malaria
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05168  Herpes simplex virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05321  Inflammatory bowel disease
ptr05323  Rheumatoid arthritis
ptr05332  Graft-versus-host disease
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    450200 (IL1B)
   04064 NF-kappa B signaling pathway
    450200 (IL1B)
   04668 TNF signaling pathway
    450200 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    450200 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    450200 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    450200 (IL1B)
   04620 Toll-like receptor signaling pathway
    450200 (IL1B)
   04621 NOD-like receptor signaling pathway
    450200 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    450200 (IL1B)
   04625 C-type lectin receptor signaling pathway
    450200 (IL1B)
   04659 Th17 cell differentiation
    450200 (IL1B)
   04657 IL-17 signaling pathway
    450200 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    450200 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    450200 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    450200 (IL1B)
   05321 Inflammatory bowel disease
    450200 (IL1B)
   05332 Graft-versus-host disease
    450200 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    450200 (IL1B)
   05020 Prion disease
    450200 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    450200 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    450200 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    450200 (IL1B)
   04932 Non-alcoholic fatty liver disease
    450200 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    450200 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    450200 (IL1B)
   05135 Yersinia infection
    450200 (IL1B)
   05133 Pertussis
    450200 (IL1B)
   05134 Legionellosis
    450200 (IL1B)
   05152 Tuberculosis
    450200 (IL1B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    450200 (IL1B)
   05164 Influenza A
    450200 (IL1B)
   05162 Measles
    450200 (IL1B)
   05168 Herpes simplex virus 1 infection
    450200 (IL1B)
   05163 Human cytomegalovirus infection
    450200 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    450200 (IL1B)
   05144 Malaria
    450200 (IL1B)
   05140 Leishmaniasis
    450200 (IL1B)
   05142 Chagas disease
    450200 (IL1B)
   05143 African trypanosomiasis
    450200 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    450200 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    450200 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    450200 (IL1B)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   450200 (IL1B)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Cytokines
   450200 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 450200
NCBI-ProteinID: XP_001147075
Ensembl: ENSPTRG00000012372
VGNC: 1940
UniProt: H2QIK6 A0A663DG51
LinkDB
Position
2A
AA seq 269 aa
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAVSVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWENEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
NT seq 810 nt   +upstreamnt  +downstreamnt
atggcagaagtacctgaactcgccagtgaaatgatggcttattacagtggcaatgaggat
gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac
ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc
ttcaggcaggccgtgtcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcttcgacacatgggaaaacgaggcttatgtgcacgatgcacctgtacga
tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa
aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system