Pan troglodytes (chimpanzee): 450200 Help Entry 450200            CDS       T01005                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01523   Antifolate resistance ptr04010   MAPK signaling pathway ptr04060   Cytokine-cytokine receptor interaction ptr04064   NF-kappa B signaling pathway ptr04217   Necroptosis ptr04380   Osteoclast differentiation ptr04620   Toll-like receptor signaling pathway ptr04621   NOD-like receptor signaling pathway ptr04623   Cytosolic DNA-sensing pathway ptr04625   C-type lectin receptor signaling pathway ptr04640   Hematopoietic cell lineage ptr04657   IL-17 signaling pathway ptr04659   Th17 cell differentiation ptr04668   TNF signaling pathway ptr04750   Inflammatory mediator regulation of TRP channels ptr04932   Non-alcoholic fatty liver disease ptr04933   AGE-RAGE signaling pathway in diabetic complications ptr04936   Alcoholic liver disease ptr04940   Type I diabetes mellitus ptr05010   Alzheimer disease ptr05020   Prion disease ptr05022   Pathways of neurodegeneration - multiple diseases ptr05132   Salmonella infection ptr05133   Pertussis ptr05134   Legionellosis ptr05135   Yersinia infection ptr05140   Leishmaniasis ptr05142   Chagas disease ptr05143   African trypanosomiasis ptr05144   Malaria ptr05146   Amoebiasis ptr05152   Tuberculosis ptr05162   Measles ptr05163   Human cytomegalovirus infection ptr05164   Influenza A ptr05168   Herpes simplex virus 1 infection ptr05171   Coronavirus disease - COVID-19 ptr05321   Inflammatory bowel disease ptr05323   Rheumatoid arthritis ptr05332   Graft-versus-host disease ptr05417   Lipid and atherosclerosis ptr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     450200 (IL1B)    04064 NF-kappa B signaling pathway     450200 (IL1B)    04668 TNF signaling pathway     450200 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     450200 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     450200 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     450200 (IL1B)    04620 Toll-like receptor signaling pathway     450200 (IL1B)    04621 NOD-like receptor signaling pathway     450200 (IL1B)    04623 Cytosolic DNA-sensing pathway     450200 (IL1B)    04625 C-type lectin receptor signaling pathway     450200 (IL1B)    04659 Th17 cell differentiation     450200 (IL1B)    04657 IL-17 signaling pathway     450200 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     450200 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     450200 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     450200 (IL1B)    05164 Influenza A     450200 (IL1B)    05162 Measles     450200 (IL1B)    05168 Herpes simplex virus 1 infection     450200 (IL1B)    05163 Human cytomegalovirus infection     450200 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     450200 (IL1B)    05135 Yersinia infection     450200 (IL1B)    05133 Pertussis     450200 (IL1B)    05134 Legionellosis     450200 (IL1B)    05152 Tuberculosis     450200 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     450200 (IL1B)    05144 Malaria     450200 (IL1B)    05140 Leishmaniasis     450200 (IL1B)    05142 Chagas disease     450200 (IL1B)    05143 African trypanosomiasis     450200 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     450200 (IL1B)    05321 Inflammatory bowel disease     450200 (IL1B)    05332 Graft-versus-host disease     450200 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     450200 (IL1B)    05020 Prion disease     450200 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     450200 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     450200 (IL1B)    05418 Fluid shear stress and atherosclerosis     450200 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     450200 (IL1B)    04936 Alcoholic liver disease     450200 (IL1B)    04932 Non-alcoholic fatty liver disease     450200 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     450200 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     450200 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptr04052]     450200 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:ptr00536]     450200 (IL1B) Cytokines and neuropeptides [BR:ptr04052]  Cytokines   Interleukins    450200 (IL1B) Glycosaminoglycan binding proteins [BR:ptr00536]  Heparan sulfate / Heparin   Cytokines    450200 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  450200 NCBI-ProteinID:  XP_001147075 Ensembl:  ENSPTRG00000012372 VGNC:  1940 UniProt:  H2QIK6 A0A663DG51 LinkDB All DBs Position 2A:90620344..90628046 Genome browser AA seq 269 aa AA seqDB search MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG FRQAVSVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWENEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtacctgaactcgccagtgaaatgatggcttattacagtggcaatgaggat gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc ttcaggcaggccgtgtcagttgttgtggccatggacaagctgaggaagatgctggttccc tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa gaacctatcttcttcgacacatgggaaaacgaggcttatgtgcacgatgcacctgtacga tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system