KEGG   Pan troglodytes (chimpanzee): 450428
Entry
450428            CDS       T01005                                 

Gene name
ALOX5
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00590  Arachidonic acid metabolism
ptr01100  Metabolic pathways
ptr04664  Fc epsilon RI signaling pathway
ptr04726  Serotonergic synapse
ptr04913  Ovarian steroidogenesis
ptr05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    450428 (ALOX5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    450428 (ALOX5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    450428 (ALOX5)
  09156 Nervous system
   04726 Serotonergic synapse
    450428 (ALOX5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    450428 (ALOX5)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     450428 (ALOX5)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 450428
NCBI-ProteinID: XP_016773660
VGNC: 51965
UniProt: A0A2J8IP81
LinkDB
Position
10
AA seq 674 aa
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYTSLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYESDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccctcctacacggtcaccgtggccactggcagccagtggttcgccggcactgacgac
tacatctacctcagcctcgtgggctcggcgggctgcagcgagaagcacctgctggacaag
cccttctacaacgacttcgagcgtggcgcggtggattcgtatgacgtgactgtggacgag
gaactgggcgagatccagctggtcagaatcgagaagcgcaagtactggctgaatgacgac
tggtacctgaagtacatcacgctgaagacgccccacggggactacatcgagttcccctgc
taccgctggatcaccggcgatgtcgaggttgtcctgagggatggacgcgcaaagttggcc
cgagatgaccaaattcacattctcaagcaacaccgacgtaaagaactggaaacacggcaa
aaacaatatcgatggatggagtggaaccctggcttccccttgagcatcgatgccaaatgc
cacaaggatttaccccgtgatatccagtttgatagtgaaaaaggagtggactttgttctg
aattactccaaagcgatggagaacctgttcatcaaccgcttcatgcatatgttccagtct
tcttggaatgacttcgccgactttgagaaaatctttgtcaagatcagcaacactatttct
gagcgggtcatgaatcactggcaggaagacctgatgtttggctaccagttcctgaatggc
tgcaaccctgtgttgatccggcgctgcacagagctgcccgagaagctcccggtgaccacg
gagatggtagagtgcagcctggagcggcagctcagcttggagcaggaggtccagcaaggg
aacattttcatcgtggactttgagctgctggatggcatcgatgccaacaaaacagacccc
tgcacactccagttcctggccgctcccatctgcttgctgtataagaacctggccaacaag
attgtccccattgccatccagctcaaccaaatcccgggagatgagaaccctattttcctc
ccttcggatgcaaaatacgactggcttttggccaaaatctgggtgcgttccagtgacttc
cacgtccaccagaccatcacccaccttctgcgaacacatctggtgtctgaggtttttggc
attgcaatgtaccgccagctgcctgctgtgcaccccattttcaagctgctggtggcacac
gtgagattcaccatcgcaatcaacaccaaggcccgtgagcagctcatctgcgagtgtggc
ctctttgacaaggccaacgccacagggggcggtgggcacgtgcagatggtgcagagggcc
atgaaggacctgacctacacctccctgtgctttcccgaggccatcaaggcccggggcatg
gagagcaaagaagacatcccctactacttctaccgggacgacgggctcctggtgtgggaa
gccatcaggacgttcacggccgaggtggtagacatctactacgagagcgaccaggtggtg
gaggaggacccggagctgcaggacttcgtgaacgatgtctacgtgtacggcatgcggggc
cgcaagtcctcaggcttccccaagtcggtcaagagccgggagcagctgtcggagtacctg
accgtggtgatcttcaccgcctccgcccagcacgccgcggtcaacttcggccagtacgac
tggtgctcctggatccccaatgcgcccccaaccatgcgagccccgccgccgactgccaag
ggcgtggtgaccattgagcagatcgtggacacgctgcccgaccgcggccgctcctgctgg
catctgggtgcagtgtgggcgctgagccagttccaggaaaacgagctgttcctgggcatg
tacccagaagagcattttatcgagaagcctgtgaaggaggccatggcccgattccgcaag
aacctcgaggccattgtcagcgtgattgctgagcgcaacaagaagaagcagctgccatat
tactacttgtccccagaccggattccgaacagtgtggccatctga

DBGET integrated database retrieval system