KEGG   Pan troglodytes (chimpanzee): 451165
Entry
451165            CDS       T01005                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X2
  KO
K10140  DNA damage-binding protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03420  Nucleotide excision repair
ptr04115  p53 signaling pathway
ptr04120  Ubiquitin mediated proteolysis
ptr05161  Hepatitis B
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05210  Colorectal cancer
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05216  Thyroid cancer
ptr05217  Basal cell carcinoma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    451165 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    451165 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    451165 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    451165 (DDB2)
   05202 Transcriptional misregulation in cancer
    451165 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    451165 (DDB2)
   05212 Pancreatic cancer
    451165 (DDB2)
   05225 Hepatocellular carcinoma
    451165 (DDB2)
   05226 Gastric cancer
    451165 (DDB2)
   05214 Glioma
    451165 (DDB2)
   05216 Thyroid cancer
    451165 (DDB2)
   05220 Chronic myeloid leukemia
    451165 (DDB2)
   05217 Basal cell carcinoma
    451165 (DDB2)
   05218 Melanoma
    451165 (DDB2)
   05213 Endometrial cancer
    451165 (DDB2)
   05224 Breast cancer
    451165 (DDB2)
   05222 Small cell lung cancer
    451165 (DDB2)
   05223 Non-small cell lung cancer
    451165 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    451165 (DDB2)
   05169 Epstein-Barr virus infection
    451165 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ptr04121]
    451165 (DDB2)
   03400 DNA repair and recombination proteins [BR:ptr03400]
    451165 (DDB2)
Ubiquitin system [BR:ptr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     451165 (DDB2)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      451165 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 451165
NCBI-ProteinID: XP_001167874
Ensembl: ENSPTRG00000003558
VGNC: 7513
UniProt: H2Q3I6 A0A6D2Y6J9
LinkDB
Position
11
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgatgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

DBGET integrated database retrieval system