KEGG   Pan troglodytes (chimpanzee): 451584
Entry
451584            CDS       T01005                                 

Gene name
CD3D
Definition
(RefSeq) T-cell surface glycoprotein CD3 delta chain isoform X2
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04640  Hematopoietic cell lineage
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr05142  Chagas disease
ptr05162  Measles
ptr05166  Human T-cell leukemia virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    451584 (CD3D)
   04660 T cell receptor signaling pathway
    451584 (CD3D)
   04658 Th1 and Th2 cell differentiation
    451584 (CD3D)
   04659 Th17 cell differentiation
    451584 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    451584 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    451584 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    451584 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    451584 (CD3D)
   05162 Measles
    451584 (CD3D)
   05169 Epstein-Barr virus infection
    451584 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    451584 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptr04090]
    451584 (CD3D)
CD molecules [BR:ptr04090]
 Proteins
  451584 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Trehalose_PPase
Other DBs
NCBI-GeneID: 451584
NCBI-ProteinID: XP_003313382
Ensembl: ENSPTRG00000004339
VGNC: 6481
UniProt: A0A2I3S4Y1 A0A6D2X3H8
LinkDB
Position
11
AA seq 127 aa
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSVTWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDTYKDKESTVQVHYRTADTQALLRNDQVYQPLRDRDDVQYSRLG
GNWARNK
NT seq 384 nt   +upstreamnt  +downstreamnt
atggaacatagcacgtttctgtctggcctggtactggctacccttctctcgcaagtgagc
cccttcaagatacctatagaggaacttgaggacagagtgtttgtgaattgcaataccagc
gtcacatgggtagagggaacggtgggaacactgctctcagacattacaagactggacctg
ggaaaacgcatcctggacccacgaggaatatataggtgtaatgggacagatacatacaag
gacaaagaatctaccgtgcaagttcattatcgaactgccgacacacaagctctgttgagg
aatgaccaggtctatcagcccctccgagatcgagatgatgttcagtacagccgccttgga
ggaaactgggctcggaacaagtga

DBGET integrated database retrieval system