KEGG   Pan troglodytes (chimpanzee): 452025
Entry
452025            CDS       T01005                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04530  Tight junction
ptr04660  T cell receptor signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    452025 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    452025 (CDK4)
   04115 p53 signaling pathway
    452025 (CDK4)
   04218 Cellular senescence
    452025 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    452025 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    452025 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    452025 (CDK4)
   05203 Viral carcinogenesis
    452025 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    452025 (CDK4)
   05225 Hepatocellular carcinoma
    452025 (CDK4)
   05214 Glioma
    452025 (CDK4)
   05220 Chronic myeloid leukemia
    452025 (CDK4)
   05218 Melanoma
    452025 (CDK4)
   05219 Bladder cancer
    452025 (CDK4)
   05224 Breast cancer
    452025 (CDK4)
   05222 Small cell lung cancer
    452025 (CDK4)
   05223 Non-small cell lung cancer
    452025 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    452025 (CDK4)
   04934 Cushing syndrome
    452025 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    452025 (CDK4)
   05160 Hepatitis C
    452025 (CDK4)
   05164 Influenza A
    452025 (CDK4)
   05162 Measles
    452025 (CDK4)
   05163 Human cytomegalovirus infection
    452025 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    452025 (CDK4)
   05169 Epstein-Barr virus infection
    452025 (CDK4)
   05165 Human papillomavirus infection
    452025 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    452025 (CDK4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     452025 (CDK4)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   452025 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 452025
NCBI-ProteinID: XP_509173
Ensembl: ENSPTRG00000005147
VGNC: 8366
UniProt: H2QZZ4 A0A6D2XU49
LinkDB
Position
12
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaaccatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

KEGG   Pan troglodytes (chimpanzee): 746968
Entry
746968            CDS       T01005                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X1
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04110  Cell cycle
ptr04115  p53 signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04218  Cellular senescence
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    746968 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    746968 (CDK6)
   04115 p53 signaling pathway
    746968 (CDK6)
   04218 Cellular senescence
    746968 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    746968 (CDK6)
   05206 MicroRNAs in cancer
    746968 (CDK6)
   05203 Viral carcinogenesis
    746968 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    746968 (CDK6)
   05225 Hepatocellular carcinoma
    746968 (CDK6)
   05214 Glioma
    746968 (CDK6)
   05220 Chronic myeloid leukemia
    746968 (CDK6)
   05218 Melanoma
    746968 (CDK6)
   05224 Breast cancer
    746968 (CDK6)
   05222 Small cell lung cancer
    746968 (CDK6)
   05223 Non-small cell lung cancer
    746968 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    746968 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    746968 (CDK6)
   05164 Influenza A
    746968 (CDK6)
   05162 Measles
    746968 (CDK6)
   05163 Human cytomegalovirus infection
    746968 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    746968 (CDK6)
   05169 Epstein-Barr virus infection
    746968 (CDK6)
   05165 Human papillomavirus infection
    746968 (CDK6)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     746968 (CDK6)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  CDK family
   746968 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 746968
NCBI-ProteinID: XP_001167181
Ensembl: ENSPTRG00000019400
VGNC: 13637
UniProt: H2QUX4 A0A6D2W6Z6
LinkDB
Position
7
AA seq 326 aa
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgtgccgcgctgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacttgaagaacggaggccgtttcgtg
gcgttgaagcgcgtgcgggtgcagaccggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaactttagtgtttgaacat
gtcgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattcacaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctcgctgacttcggccttgcccgcatctatagtttccagatggctctaacctcagtggtc
gtcacgctgtggtacagagcacccgaagtcttgctccagtccagctacgccacccccgtg
gatctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgttgatcaactaggaaaaatcttggacgtaattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcattcaaaatctgcccaa
ccaattgagaagtttgtaacagatattgatgaactaggcaaagacctacttctgaagtgt
ttgacatttaacccagccaaaagaatatctgcctacagtgccctgtctcacccatacttc
caggacctggaaaggtgcaaagaaaacctggattcccacctgccgcccagccagaacacc
tcggagctgaatacagcctga

DBGET integrated database retrieval system