KEGG   Pan troglodytes (chimpanzee): 452114
Entry
452114            CDS       T01005                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X4
  KO
K05461  KIT ligand
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04916  Melanogenesis
ptr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    452114 (KITLG)
   04014 Ras signaling pathway
    452114 (KITLG)
   04015 Rap1 signaling pathway
    452114 (KITLG)
   04072 Phospholipase D signaling pathway
    452114 (KITLG)
   04151 PI3K-Akt signaling pathway
    452114 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    452114 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    452114 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    452114 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    452114 (KITLG)
Cytokines and growth factors [BR:ptr04052]
 Growth factors
  Growth factors (RTK binding)
   452114 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 452114
NCBI-ProteinID: XP_003313887
Ensembl: ENSPTRG00000005281
VGNC: 5442
UniProt: K7D1D2 A0A6D2VSD6
LinkDB
Position
12
AA seq 245 aa
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPP
GDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKER
EFQEV
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatcttcagctgctcctatttaat
cctctcgtcaaaactgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattggtggcaaatcttccaaaagactatatgataaccctcaaatatgtccccggg
atggatgttttgccaagtcattgttggataagcgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgtgaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctctttactcctgaagaattc
tttagaatttttaatagatccattgatgccttcaaggactttgtagtggcatctgaaact
agtgattgtgtggtttcttcaacattaagtcctgagaaagggaaggccaaaaatccccct
ggagactccagcctacactgggcagccatggcattgccagcattgttttctcttataatt
ggctttgcttttggagccttatactggaagaagagacagccaagtcttacaagggcagtt
gaaaatatacaaattaatgaagaggataatgagataagtatgttgcaagagaaagagaga
gagtttcaagaagtgtaa

DBGET integrated database retrieval system