KEGG   Pan troglodytes (chimpanzee): 452508
Entry
452508            CDS       T01005                                 

Gene name
FLT3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04640  Hematopoietic cell lineage
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05221  Acute myeloid leukemia
ptr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    452508 (FLT3)
   04014 Ras signaling pathway
    452508 (FLT3)
   04151 PI3K-Akt signaling pathway
    452508 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    452508 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    452508 (FLT3)
   05202 Transcriptional misregulation in cancer
    452508 (FLT3)
   05230 Central carbon metabolism in cancer
    452508 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    452508 (FLT3)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     452508 (FLT3)
Protein kinases [BR:ptr01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   452508 (FLT3)
CD molecules [BR:ptr04090]
 Proteins
  452508 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 APH
Other DBs
NCBI-GeneID: 452508
NCBI-ProteinID: XP_509601
Ensembl: ENSPTRG00000005740
VGNC: 7288
UniProt: A0A6D2WV58 H2Q7C7
LinkDB
Position
13
AA seq 993 aa
MPALARGGGRLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVISMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDPYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETMLLNSPGPFPFIQD
NISFYATIGVCLLFIVILTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPHLTSFLGCQLADAEEAMYQNVDG
CVSECPHTYQNRRPFSREMDSGPLSPQAQVEDS
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgccggcgttggcgcgcggcggcggccggctgccgctgctcgttgttttttctgcaatg
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtatcagaatccccg
gaagacctcgggtgtgcgttgagaccccagagctcagggacagtgtacgaagctgccgct
gtggaagtggatgtatctgcttccatcacactgcaagtgctggtcgacgccccagggaac
atttcctgtctctgggtctttaagcacagctccctgaattgccagccacattttgattta
caaaacagaggagttatttccatggtcattttgaaaatgacagaaacccaagctggagaa
tacctactttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgctttacacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagctgtaaagaagaaagtccagctgttgttaaaaaggaggaaaaagtg
cttcatgaattatttgggacggacataaggtgctgtgccagaaatgaactgggcagggaa
tgcaccaggctgttcacaatagatctaaatcaaactcctcagaccacattgccacaatta
tttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtgaaccatgga
ttcgggctcacctgggaattagaaaacaaagcactcgaggagggcaactactttgagatg
agtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatcagtg
gcaagaaacgacaccggatactacacttgttcctcttcaaagcatcccagtcaatcagct
ttggttaccatcgtagaaaagggatttataaatgctaccaattcaagtgaagattatgaa
attgacccatatgaagagttttgtttttctgtcaggtttaaagcctacccacaaatcaga
tgtacgtggaccttctctcgaaaatcatttccttgtgagcaaaagggtcttgataacgga
tacagcatatccaagttttgcaatcataagcaccagccaggagaatatatattccatgca
gaaaatgatgatgcccaatttaccaaaatgttcacgctgaatataagaaggaaacctcaa
gtgctcgcagaagcatcggcaagtcaggcgtcctgtttctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcacagaa
ggagtctggaatagaaaggctaacagaaaagtgtttggacagtgggtgtcgagcagtact
ctaaacatgagtgaagccataaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatgcttttaaactctccaggccccttccctttcatccaagac
aacatctcattctatgcaacaattggtgtttgtctcctcttcattgtcattttaaccctg
ctaatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgactggctcctcagataatgagtacttctacgttgatttcagagaatatgaatatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtactaggatcaggtgct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgccgtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaatctgctgggggcg
tgcacactgtcaggaccaatttacttgatttttgaatactgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagaagttcagatacacccggactcggatcaaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaagaagaggaggacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgcttgtcacc
cacgggaaagtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccccgaaagcctg
tttgaaggcatctacaccattaagagtgatgtctggtcatatggaatattactgtgggaa
atcttctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcaaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaatcctgctgggcttttgactcaaggaaacggccatccttccctcatttgact
tcgtttttaggatgtcagctggcagatgcagaagaagcgatgtatcagaatgtggatggc
tgtgtttcggaatgtcctcacacctaccaaaacaggcgacctttcagcagagagatggat
tcggggccactctctccgcaggctcaggtcgaagattcgtag

DBGET integrated database retrieval system