KEGG   Pan troglodytes (chimpanzee): 452520
Entry
452520            CDS       T01005                                 

Gene name
ALOX5AP
Definition
(RefSeq) arachidonate 5-lipoxygenase-activating protein isoform X1
  KO
K20735  arachidonate 5-lipoxygenase-activating protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04664  Fc epsilon RI signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    452520 (ALOX5AP)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 452520
NCBI-ProteinID: XP_016780609
VGNC: 7283
UniProt: A0A2J8MLT5
LinkDB
Position
13
AA seq 161 aa
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatcaagaaactgtaggcaatgttgtcctgttggccattgtcaccctcatcagcgtg
gtccagaatggattctttgcccataaagtggagcacgaaagcaggacccagaatgggagg
agcttccagaggaccggaacacttgcctttgagcgggtctacactgccaaccagaactgt
gtagatgcgtaccccactttcctcgctgtgctctggtctgcggggctactttgcagccaa
gttcctgctgcctttgctgggctgatgtacttgtttgtgaggcaaaagtactttgtcggt
tacctaggagagagaacgcagagcacccctggctacatatttgggaaacgcatcatactc
ttcctgttcctcatgtctgttgctggcatattcaactattacctcatcttctttttcgga
agtgactttgaaaactacataaagacgatctccaccaccatctcccctctacttctcatt
ccctaa

DBGET integrated database retrieval system