KEGG   Pan troglodytes (chimpanzee): 452715
Entry
452715            CDS       T01005                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X2
  KO
K06618  retinoblastoma-associated protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01522  Endocrine resistance
ptr04110  Cell cycle
ptr04218  Cellular senescence
ptr04934  Cushing syndrome
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05212  Pancreatic cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    452715 (RB1)
   04218 Cellular senescence
    452715 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    452715 (RB1)
   05203 Viral carcinogenesis
    452715 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    452715 (RB1)
   05225 Hepatocellular carcinoma
    452715 (RB1)
   05226 Gastric cancer
    452715 (RB1)
   05214 Glioma
    452715 (RB1)
   05220 Chronic myeloid leukemia
    452715 (RB1)
   05218 Melanoma
    452715 (RB1)
   05219 Bladder cancer
    452715 (RB1)
   05215 Prostate cancer
    452715 (RB1)
   05224 Breast cancer
    452715 (RB1)
   05222 Small cell lung cancer
    452715 (RB1)
   05223 Non-small cell lung cancer
    452715 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    452715 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    452715 (RB1)
   05161 Hepatitis B
    452715 (RB1)
   05160 Hepatitis C
    452715 (RB1)
   05163 Human cytomegalovirus infection
    452715 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    452715 (RB1)
   05169 Epstein-Barr virus infection
    452715 (RB1)
   05165 Human papillomavirus infection
    452715 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    452715 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptr01009]
    452715 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    452715 (RB1)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     452715 (RB1)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    452715 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 452715
NCBI-ProteinID: XP_016781178
Ensembl: ENSPTRG00000005864
VGNC: 14463
LinkDB
Position
13
AA seq 816 aa
MSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELI
YLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPP
VLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVY
FKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFE
TQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPK
ESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQN
FSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVI
ESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPL
NLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYK
KVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGIC
KVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYA
STRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRIL
VSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLP
GESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtcgttcacttttactgagctacagaaaaacatagaaatcagtgtccataaattcttt
aacttactaaaagaaattgataccagtaccaaagttgataatgctatgtcaagactgttg
aagaagtatgatgtattgtttgcactcttcagcaaattggaaaggacatgtgaacttata
tatttgacacaacccagcagttcgatatctactgaaataaattctgcattggtgctaaaa
gtttcttggatcacatttttattagctaaaggggaagtattacaaatggaagatgatctg
gtgatttcatttcagttaatgctatgtgtccttgactattttattaaactctcacctccc
gtgttgctcaaagaaccatataaaacagctgttatacccattaatggttcacctcgaaca
cccaggcgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgatacaaga
attattgaagttctctgtaaagaacatgaatgtaatatagatgaggtgaaaaatgtttat
ttcaaaaattttataccttttatgaattctcttggacttgtaacatctaatggacttcca
gaggttgaaaatctttctaaacgatacgaagaaatttatcttaaaaataaagatctagat
gcaagattatttttggatcatgataaaactcttcagactgattctatagacagttttgaa
acacagagaacaccacgaaaaagtaaccttgatgaagaggtgaatgtcattcctccacac
actccagttaggactgttatgaacactatccaacaattaatgatgattttaaattcagca
agtgatcaaccttcagaaaatctgatttcctattttaacaactgcacagtgaatccaaaa
gaaagtatactgaaaagagtgaaggatataggatacatctttaaagagaaatttgctaaa
gctgtgggacagggttgtgtcgaaattggatcacagcgatacaaacttggagttcgcttg
tattaccgagtaatggaatccatgcttaaatcagaagaagaacgattatccattcaaaat
tttagcaaacttctgaatgacaacatttttcatatgtctttattggcgtgcgctcttgag
gttgtaatggccacatatagcagaagtacatctcagaatcttgattctggaacagatttg
tctttcccatggattctgaatgtgcttaatttaaaagcctttgatttttacaaagtgatc
gaaagttttatcaaagcagaaggcaacttgacaagagaaatgataaaacatttagaacga
tgtgaacatcgaatcatggaatcccttgcatggctctcagattcacctttatttgatctt
attaaacaatcaaaggaccgagaaggaccaactgatcaccttgaatctgcttgtcctctt
aatcttcctctccagaataatcacactgcagcagatatgtatctttctcctgtaagatct
ccaaagaaaaaaggttcaactacgcgtgtaaattctactgcaaatgcagagacacaagca
acctcagccttccagacccagaagccattgaaatctacctctctttcactgttttataaa
aaagtgtatcggctagcctatctccggctaaatacactttgtgaacgccttctgtctgag
cacccagaattagaacatatcatctggacccttttccagcacaccctgcagaatgagtat
gaactcatgagagacaggcatttggaccaaattatgatgtgttccatgtatggtatatgc
aaagtgaagaatatagaccttaaattcaaaatcattgtaacagcatacaaggatcttcct
catgctgttcaggagacattcaaacgtgttttgatcaaagaagaggagtatgattctatt
atagtattctataactcggtcttcatgcagagactgaaaacaaatattttgcagtatgct
tccaccaggccccctaccttgtcaccaatacctcacattcctcgaagcccttacaagttt
cctagttcacccttacggattcctggagggaacatctatatttcacccctgaagagtcca
tataaaatttcagaaggtctgccaacaccaacaaaaatgactccaagatcaagaatctta
gtatcaattggtgaatcattcgggacttctgagaagttccagaaaataaatcagatggta
tgtaacagcgaccgtgtgctcaaaagaagtgctgaaggaagcaaccctcctaaaccactg
aaaaaactacgctttgatattgaaggatcagatgaagcagatggaagtaaacatctccca
ggagagtccaaatttcagcagaaactggcagaaatgacttctactcgaacacgaatgcaa
aagcagaaaatgaatgatagcatggatacctcaaacaaggaagagaaatga

DBGET integrated database retrieval system