KEGG   Pan troglodytes (chimpanzee): 452906
Entry
452906            CDS       T01005                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    452906 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ptr04030]
    452906 (PTGDR)
G protein-coupled receptors [BR:ptr04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    452906 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 ResB PhoR
Other DBs
NCBI-GeneID: 452906
NCBI-ProteinID: XP_016781577
VGNC: 12590
UniProt: A0A2I3SBT1 A0A6D2XPJ0
LinkDB
Position
14
AA seq 359 aa
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPSLDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQLVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDRAELRADGKEASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaagtcgcccttctaccgctgccagaacaccacctctgtggaaaaaggcaactcggcg
gtgatgggcggggtgctcttcagcaccggcctcctgggcaacctgctggccctggggctg
ctggcgcgctcggggctggggtggtgctcgcggcgtccactgcgcccgctgccctcggtc
ttctacatgctggtgtgtggcctgacggtcaccgacttgctgggcaagtgcctcctaagc
ccggtggtgctggctgcctacgctcagaaccggagtctgcgggtgcttgcgccctcattg
gacaactcgttgtgccaagccttcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcactggagtgctggctctccctagggcaccctttcttctac
cgacggcacatcaccctgcgcctgggcgcactggtggccccggtggtgagcgccttctcc
ctggctttctgcgcgctacctttcatgggcttcgggaagttcgtgcagtactgccccggc
acctggtgctttatccagctggtccacgaggagggctcgctgtcggtgctggggtactct
gtgctctactccagcctcatggcgctgctggtcctcgccaccgtgctgtgcaacctcggc
gccatgcgcaacctctatgcgatgcaccggcggctgcagcggcacccgcgctcctgcacc
agggaccgtgccgagctgcgcgcggacgggaaagaagcgtcccctcagcccctggaggag
ctggatcacctcctgctgctggcgctgatgaccgtgctcttcactatgtgttctctgccc
gtaatttatcgcgcttactatggagcatttaaggatgtcaaggagaaaaacaggacctct
gaagaagcagaagacctccgagccttgcgatttctatctgtgatttcaattgtggaccct
tggatttttatcattttcagatctccagtatttcggatattttttcacaagattttcatt
agacctcttaggtacaggagccggtgcagcaattccactaacatggaatccagtctgtga

DBGET integrated database retrieval system