KEGG   Pan troglodytes (chimpanzee): 453068Help
Entry
453068            CDS       T01005                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X7
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00350  Tyrosine metabolism
ptr01100  Metabolic pathways
Module
ptr_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    453068 (GSTZ1)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     453068 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 453068
NCBI-ProteinID: XP_009426472
Ensembl: ENSPTRG00000038857
VGNC: 12663
UniProt: A0A2I3SB66
LinkDB All DBs
Position
14
AA seq 217 aa AA seqDB search
MTESGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQV
PALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVL
KQVREEMQLTWAQNAITSGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVD
LTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacagagtctggcaagcccatcctctattcctatttccgaagctcctgctcatggaga
gttcgaattgctctggccttgaaaggcatcgactacgagacggtgcccatcaatctcata
aaggatgggggccaacagttctctaaggacttccaggcactgaatcctatgaagcaggtg
ccagccctgaagattgatggaatcaccattcaccagtcactggccatcattgagtatcta
gaggagacgcgtcccactccgcgacttctgcctcaggacccaaagaagagggccagcgtg
cgtatgatttctgacctcatcgctggtggcatccagcccctgcagaacctgtctgtcctg
aagcaagtgcgagaggagatgcagctgacctgggcccagaacgccatcacttctggcttt
aacgccctggagcagatcctacagagcacagcgggcatatactgtgtaggagacgaggtg
accatggctgatctgtgcttggtgcctcaggtggcaaatgctgaaagattcaaggtggat
ctcaccccctaccctaccatcagctccatcaacaagaggctgctggtcttggaggccttc
caggtgtctcacccctgccggcagccagatacacccactgagctgagggcctag

DBGET integrated database retrieval system