KEGG   Pan troglodytes (chimpanzee): 453361Help
Entry
453361            CDS       T01005                                 

Definition
(RefSeq) neutral alpha-glucosidase C isoform X12
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00052  Galactose metabolism
ptr00500  Starch and sucrose metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    453361
   00500 Starch and sucrose metabolism
    453361
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     453361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 453361
NCBI-ProteinID: XP_009427169
LinkDB All DBs
Position
15
AA seq 754 aa AA seqDB search
MEAAVKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEET
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPKPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGICFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNELFGVLKMRTLY
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgtgaaagaggaaataagtgttgaagatgaagctgtagataaaaacatt
ttcagagactgtaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggcattactggactcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttcctctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccagatttgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctctggggacacaggcagt
ctgatattggcagatggaaaaggagacctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccaattatac
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgaggaggagaca
tcagtggacacctctcaggaaaatcaagaagatctgggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggcccttcttctattggtttggatttctccttgcat
ggatttgagcatctttatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatggagatgcttaccgtctttataacctggatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggtattttctggctgaatgcctcggaaacactggtggagatcaatacagagcctgcagta
gagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcagatctcgcact
catgtgcactggatgtcagagagtggcatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcacaccttacaggcacacaagccatgccccctctt
ttctctttgggataccaccagtgccgctggaactatgaagatgagcaggatgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaacagattcccaaagcccaagagg
atgcaagagctgctcaggagcaaaaagcgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgaag
aatcaggaaggggaagactttgaaggggtgtgttggccaggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctacggacatcctcttcctttggaatgacatgaatgagccttctgtctttagaggg
ccagagcaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagagctc
cacaacatctacggtttttatcatcaaatggctactgcagaaggactgataaaacgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgccgtgtggacgggcgacaatacagcagaatggagcaacttgaaaatttctatccca
atgttactcactctcagcattactgggatctgtttttgcggagctgacataggcgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgagagccttggctctttggggag
gaacacacccgactcatccgagaagccatcagagagcgctatggcctcctgccatattgg
tattctctgttctaccatgcacacgtggcttcccaacctgtcatgaggcctctgtgggta
gagttccctgatgaactaaagacttttgatatggaagatgaatacatgctggggagtgca
ttattggttcatccagtcacagaaccaaaagccaccacagttgatgtgtttcttccagga
tcaaatgagttatttggagttctgaagatgaggactctttactaa

DBGET integrated database retrieval system