KEGG   Pan troglodytes (chimpanzee): 453394Help
Entry
453394            CDS       T01005                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00040  Pentose and glucuronate interconversions
ptr00051  Fructose and mannose metabolism
ptr01100  Metabolic pathways
Module
ptr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    453394 (SORD)
   00051 Fructose and mannose metabolism
    453394 (SORD)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     453394 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_25 Pyr_redox_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 453394
NCBI-ProteinID: XP_003952695
Ensembl: ENSPTRG00000007025
VGNC: 13426
UniProt: H2Q9C4
LinkDB All DBs
Position
15
AA seq 357 aa AA seqDB search
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNF
IVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFC
ATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCG
AGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGLL
GCKPEVTMECTGAETSIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAVREVDIKGVFRY
CNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMIKCDPSDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccaagcccaacaacctttccctggtggtgcacggaccgggggacttg
cgcctggagaactatcctatccctgaaccaggcccaaatgaggtcttgctgaggatgcat
tctgttggaatctgtggctcagatgtccactactgggagtatggtcgaattgggaatttt
attgtgaaaaagcccatggtgctgggacatgaagcttcgggaacagtcgaaaaagtggga
tcatcggtaaagcacctaaaaccaggtgatcgtgttgccatcgagcctggtgctccccga
gaaaatgatgaattctgcaagatgggccgatacaatctgtcaccttccatcttcttctgt
gccacaccccccgatgacgggaacctctgccggttctataagcacaatgcagccttttgt
tacaagcttcctgacaatgtcacctttgaggaaggcgccctgatcgagccactttctgtg
gggatccatgcctgcaggagaggcggagttaccctgggacacaaggtccttgtgtgtgga
gctgggccaatcgggatggtcactttgctcgtggccaaagcaatgggagcagctcaagta
gtggtgactgatctgtctgctacccgattgtccaaagccaaggagattggggctgattta
gttctccagatctccaaggagagccctcaggaaatcgccaggaaagtagaaggtctgctg
gggtgcaagccggaagtcaccatggagtgcacgggggcagagacctccatccaggcgggc
atctacgccactcgctctggtgggaccctcgtgcttgtggggctgggctctgagatgacc
accgtacccctactgcatgcagccgtccgggaggtggatatcaagggtgtgtttcgatac
tgcaacacgtggccagtggcgatttcgatgcttgcgtccaagtctgtgaacgtaaaaccc
ctcgtcacccataggtttcctctggagaaagctctggaggcctttgaaacatttaaaaag
ggattggggttgaaaatcatgatcaagtgtgaccccagtgaccagaatccctga

DBGET integrated database retrieval system