KEGG   Pan troglodytes (chimpanzee): 453813Help
Entry
453813            CDS       T01005                                 

Gene name
CACNA1H
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1H isoform X10
  KO
K04855  voltage-dependent calcium channel T type alpha-1H
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04020  Calcium signaling pathway
ptr04713  Circadian entrainment
ptr04925  Aldosterone synthesis and secretion
ptr04927  Cortisol synthesis and secretion
ptr04929  GnRH secretion
ptr04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    453813 (CACNA1H)
   04020 Calcium signaling pathway
    453813 (CACNA1H)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    453813 (CACNA1H)
   04925 Aldosterone synthesis and secretion
    453813 (CACNA1H)
   04927 Cortisol synthesis and secretion
    453813 (CACNA1H)
  09159 Environmental adaptation
   04713 Circadian entrainment
    453813 (CACNA1H)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    453813 (CACNA1H)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptr04040]
    453813 (CACNA1H)
Ion channels [BR:ptr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   453813 (CACNA1H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 453813
NCBI-ProteinID: XP_016784609
VGNC: 51205
LinkDB All DBs
Position
16
AA seq 2175 aa AA seqDB search
MMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFF
IFGIVGVQLWAGLLRNRCFLDSAFVRNNNLTFLRPYYQTEEGEENPFICSSRRDNGMQKC
SHIPGRRELRVPCTLGWEAYTQPQAEGVGAARNACINWNQYYNVCRSGDSNPHNGAINFD
NIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQF
SETKQRESQLMREQRARHLSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLYARW
QSRWRKKVDPSAVQGQGPGHRQRRAGRHTASVHHLVYHHHHHHHHHYHFSHGSPRRPGPE
PGACDTRLVRAGAPPSPPSPGRGPPDAESVHSIYHADCHIEGPQERARVAHAAATAAASL
RLATGLGTMNYPTILPSGVGSGKGSTSPGPKGKWAGGPPGTGGHGPLSLNSPDPYEKIPH
VVGEHGLGQAPGHLSGLSVPCPLPSPPAGTLTCELKSCPYCTRALEDPEGELSGSESGDS
DGRGVYEFTQDIRHGDRRDPTRPPPATDTPGPGPGSPRRRAQQRAAPGEPGWMGRLWVTF
SGKLRRIVDSKYFSRGIMMAILVNTLSMGVEYHEQPEELTNALEISNIVFTSMFALEMLL
KLLACGPLGYIRNPYNIFDGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPALR
RQLVVLVKTMDNVATFCTLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLW
AIVTVFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEG
DANRSDTDEDKTSVHFEEDLHKLRELQSAELKMCSLAVTPNGHLEGRGSLSPPLIMCTAA
TPMPTPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKPPASLRSSPCAPWGPSGAWSSRR
SSWSSLGRAPSLKRRGQCGERESLLSGEGKGSTDDEAEDGRAAPGPRATPLRRAESLDPR
PLRPAALPPTKCRDRDGQVVALPSDFFLRIDSHREDAAELDDDSEDSCCLRLHKVLEPYK
PQWCRSREAWALYLFSPQNRFRVSCQKVITHKMFDHVVLVFIFLNCVTIALERPDIDPGS
TERVFLSVSNYIFTAIFVAEMMVKVVALGLLSGEHAYLQSSWNLLDGLLVLVSLVDIVVA
MASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFI
IFGILGVQLFKGKFYYCEGPDTRNISTKAQCRAAHYRWVRRKYNFDNLGQALMSLFVLSS
KDGWVNIMYDGLDAVGVDQQPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCR
QHQEAEEARRREEKRLRRLERRRRSKALPVAVAEAQRRPYYADYSPTRRSIHSLCTSHYL
DLFITFIICVNVITMSMEHYNQPKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKD
RWNQLDLAIVLLSLMGITLEEIEMSAALPINPTIIRIMRVLRIARVLKLLKMATGMRALL
DTVVQALPQVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFL
TLFRVSTGDNWNGIMKDTLRECSREDKHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVL
MKHLEESNKEAREDAELDAEIELEMAQGPGSARWVDADRPPLPQESPGARDAPNLLVARK
VSVSRMLSLPNDSYMFRPVVPASAPHPRPLQEVEMETYGAGTPLGSVASVHSPPAESCAS
LQIPLAVSSPARSGEPLHALSPRGTARSPSLSRLLCRQEAVHTDSLEGKIDSPRDTLDPA
EPGEKTPVRPVTQGGSLQSPPRSPRPASVRTRKHIFGQRCVSSRPAAPGGEEAEVSDPAD
EEVSHITSSACPWQPTAVPHGPEASPVASGERDPRRLYSVDAQGFLDKPGRADEQWRPSA
EPGSGEPGEAKAWGPEAEPALGARRKKKMSPPCISVEPPAEDEGSARPPAAEGGSTTLRR
RTPSCEATPHRDSLEPTEGSGAGGDPAAKGERWGQASCRAEHLTVPSFAFEPLDLGVPSG
DPFLDGSHSVTPESRASSSGAIVPLEPPESEPPMPVGDPPEKRRGLYLTVPQCPLEKPGS
PSTTPAPGGGADDPV
NT seq 6528 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtactcgttggacggacacaacgtgagcctctcggctatcaggaccgtgcgg
gtgctgcggcccctccgcgccatcaaccgcgtgcctagcatgcggatcctggtcactctg
ctgctggatacgctgcccatgctcgggaacgtccttctgctgtgcttcttcgtcttcttc
attttcggcatcgttggcgtccagctttgggctggcctcctgcggaaccgctgctttctg
gacagtgcctttgtcaggaacaacaacctgaccttcctgcggccgtactaccagacggag
gagggcgaggagaacccgttcatctgctcctcgcgccgagacaacggcatgcagaagtgc
tcgcacatccccggccgccgcgagctgcgcgtgccctgcaccctgggctgggaggcctac
acgcagccgcaggccgagggggtgggcgctgcacgcaacgcctgcatcaactggaaccag
tactacaacgtgtgccgctcgggtgactccaacccccacaacggtgccatcaacttcgac
aacatcggctacgcctggattgccatcttccaggtgatcacgctggaaggctgggtggac
atcatgtactacgtcatggacgcccactcgttctacaacttcatctatttcatcctgctc
atcatcgtgggctccttcttcatgatcaacctgtgcctggtggtgattgccacgcagttc
tcggagacgaagcagcgggagagtcagctgatgcgggagcagcgggcacgccacctgtcc
aacgacagcacgctggccagcttctccgagcctggcagctgctacgaagagctgctgaag
tacgtgggccacatattccgcaaggtcaagcggcgcagcttgcgcctctacgcccgctgg
cagagccgctggcgcaagaaggtggaccccagtgctgtgcaaggccagggtcccgggcac
cgccagcgccgggcgggcaggcacacagcctcggtgcaccacctggtctaccaccaccat
caccaccaccaccaccactaccatttcagccacggcagcccccgcaggcctggccccgag
ccaggcgcctgcgacaccaggctggtccgagctggcgcgcccccctcaccaccttcccca
ggccgcggaccccccgatgcagagtcagtgcacagcatctaccatgccgactgccacata
gaggggccgcaggagagggcccgggtggcacatgccgcagccactgccgccgccagcctc
aggctggccacagggctgggcaccatgaactaccccacgatcctgccctcaggggtgggc
agcggcaaaggcagcaccagccccggacccaaggggaagtgggccggtggaccgccaggc
accggggggcacggcccgttgagcttgaacagccctgatccctacgagaagatcccgcat
gtggtcggggagcatggactgggccaggcccctggccatctgtcgggcctcagtgtgccc
tgccccctgcccagccccccagcgggcacactgacctgtgagctgaagagctgcccgtac
tgcacccgtgccctggaggacccggagggtgagctcagcggctcggaaagtggagactca
gatggccgtggcgtctatgaattcacgcaggacatccggcacggtgaccgccgggacccc
acgcgaccaccccctgcgacggacacaccaggcccaggcccaggcagcccccggcggcgg
gcacagcagagggcagccccgggcgagccaggctggatgggccgcctctgggttaccttc
agcggcaagctgcgccgcatcgtggacagcaagtacttcagccgtggcatcatgatggcc
atcctcgtcaacacgctgagcatgggcgtggagtaccatgagcagcccgaggagctgact
aacgctctggagatcagcaacatcgtgttcaccagcatgttcgccctggagatgctgctg
aagctgctggcctgcggccctctgggctacatccggaacccgtacaacatcttcgacggc
atcattgtggtcatcagcgtctgggagatcgtggggcaggcggacggtggcttgtctgtg
ctgcgcaccttccggctgctgcgtgtgctgaagctggtgcgctttctgccagccctgcgg
cgccagctcgtggtgctggtgaagaccatggacaacgtagctaccttctgcacgctgctc
atgctcttcattttcatcttcagcatcctgggcatgcaccttttcggctgcaagttcagc
ctgaagacagacaccggagacaccgtgcctgacaggaagaacttcgactccctgctgtgg
gccatcgtcaccgtgttccagatcctgacccaggaggactggaacgtggtcctgtacaac
ggcatggcctccacctcctcctgggccgccctctacttcgtggccctcatgaccttcggc
aactacgtgctcttcaacctgctggtggccatcctcgtggagggcttccaggcggagggc
gatgccaacagatccgacacggacgaggacaagacgtcggtccacttcgaggaggacttg
cacaagctcagagaactccagagcgcagagctgaagatgtgttccctggccgtgaccccc
aacgggcacctggagggacgaggcagcctgtcccctcccctcatcatgtgcacagctgcc
acgcccatgcctacccccaagagttcgccattcctggatgcagcccccagcctcccagac
tctcggcgtggcagcagcagctccggggacccgccactgggagaccagaagcctccggcc
agcctccgaagttctccctgtgccccctggggccccagtggcgcctggagcagccggcgc
tccagctggagcagcctgggccgtgcccccagcctcaagcgccgcggccagtgtggggaa
cgtgagtccctgctgtctggcgagggcaagggcagcaccgacgacgaagctgaggacggc
agggccgcgcccgggccccgtgccaccccactgcggcgggccgagtccctggacccacgg
cccctgcggccggccgccctcccgcctaccaagtgccgcgatcgcgacgggcaggtggtg
gccctgcccagcgacttcttcctgcgcatcgacagccaccgtgaggacgcggccgagctt
gacgacgactcggaggacagctgctgcctccgcctgcataaagtgctggagccctacaag
ccccagtggtgccggagccgcgaggcctgggccctctacctcttctccccacagaaccgg
ttccgcgtctcctgccagaaggtcatcacacacaagatgtttgatcacgtggtcctcgtc
ttcatcttcctcaactgcgtcaccatcgccctggagaggcctgacattgaccccggcagc
accgagcgggtcttcctcagcgtctccaattacatcttcacggccatcttcgtggcggag
atgatggtgaaggtggtggccctggggctgctgtccggcgagcacgcctacctgcagagc
agctggaacctgctggatgggctgctggtgctggtgtccctggtggacattgtcgtggcc
atggcctcggctggtggcgccaagatcctgggtgttctgcgcgtgctgcgtctgctgcgg
accctgcggcctctgagggtcatcagccgggccccaggcctcaagctggtggtggagacg
ctgatatcgtcgctcaggcccattgggaacatcgtcctcatctgctgcgccttcttcatc
atttttggcatcttgggcgtgcagctcttcaaagggaagttctactactgcgagggcccc
gacaccaggaacatctccaccaaggcacagtgccgggccgcccactaccgctgggtgcga
cgcaagtacaacttcgacaacctgggccaggccctgatgtcgctgtttgtgctgtcatcc
aaggatggatgggtgaacatcatgtacgacgggctggacgctgtgggtgtcgaccagcag
cctgtgcagaaccacaacccctggatgctgctgtacttcatctccttcctgctcatcgtc
agcttcttcgtgctcaacatgttcgtgggcgtcgtggtcgagaacttccacaagtgccgg
cagcaccaggaggcggaggaggcgcggcggcgtgaggagaagcggctgcggcgcctagag
aggaggcgcaggagtaaggcgctcccggtggcggtggcggaggcccagcgccggccctac
tatgccgactactcgcccacgcgccgctccattcactcgctgtgcactagccactatctc
gatctcttcatcaccttcatcatctgcgtcaacgtcatcaccatgtccatggagcactat
aaccaacccaagtcgctggacgaggccctcaagtactgcaactacgtgttcaccatcgtg
tttgtcttcgaggctgcactgaagctggtagcatttgggttccgtcggttcttcaaggac
aggtggaaccagctggacctggccatcgtgctgctgtcactcatgggcatcacgctggag
gagatagagatgagcgccgcgctgcccatcaaccccaccatcatccgcatcatgcgcgtg
ctccgcatagcccgtgtgctgaagctgctgaagatggccacaggcatgcgcgccctgctg
gacactgtggtgcaagctctcccccaggtggggaacctgggccttcttttcatgctcctg
ttttttatctatgctgcgctgggagtggagctgttcgggaggctggagtgcagtgaagac
aacccctgcgagggcctgagcaggcacgccaccttcagcaacttcggcatggccttcctc
acgctgttccgcgtgtccacgggggacaactggaacgggatcatgaaggacacgctgcgc
gagtgctcccgtgaggacaagcactgcctgagctacctgccagccctgtcgcccgtctac
ttcgtgaccttcgtgctggtggcccagttcgtgctggtgaacgttgtggtagccgtgctc
atgaagcacctggaggagagcaacaaggaggcacgggaggatgcggagctggacgccgag
atcgagctggagatggcgcagggccccgggagtgcacgctgggtggacgcggacaggcct
cccttgccccaggagagtccgggcgccagggacgccccaaacctcctggttgcacgcaag
gtgtccgtgtccaggatgctctcgctgcccaacgacagctacatgttcaggcccgtggtg
cctgcctcggcgcctcacccccgcccgctgcaggaggtggagatggagacctatggggcc
ggcacccccttgggctccgttgcctctgtgcactctccgcccgcagagtcctgtgcctcc
ctccagatcccattggctgtgtcgtccccagccaggagcggcgagcccctccacgccctg
tcccctcggggcacagcccgctcccccagtctcagccggctgctctgcagacaggaggct
gtgcacaccgattccttggaagggaagattgacagccctagggacaccctggatcctgca
gagcctggcgagaaaaccccggtgaggccggtgacccaggggggctccctgcagtcccca
ccacgctccccacggcccgccagcgtccgcactcgtaagcatatctttggacagcgctgc
gtctccagccggccggcggccccaggcggagaggaggctgaggtctcggacccagccgac
gaggaggtcagccacatcaccagctccgcctgcccctggcagcccacagccgtgccccat
ggccccgaagcctctccggtggccagcggcgagcgggacccgcgcaggctctacagcgtg
gacgctcagggcttcctggacaagccgggccgggcagacgagcagtggcggccctcggcg
gagccgggcagcggggagcccggggaggcgaaggcctggggccctgaggccgagcccgct
ctgggtgcacgcagaaagaagaagatgagccccccctgcatctcagtggaaccccctgcg
gaggatgagggctccgcgcggccccccgcggcagagggcggcagcaccacactgagacgt
aggaccccgtcctgtgaggccacccctcacagggactccctggagcccacagagggctca
ggcgccgggggggaccctgcagccaagggggagcgctggggccaggcctcctgccgggcc
gagcacctgaccgtccccagctttgcctttgagccgctggacctcggggtccccagtgga
gaccctttcttggacggtagccacagtgtgaccccagaatccagagcttcctcttcaggg
gccatagtgcccctggaacccccagaatcagagcctcccatgcccgtcggtgacccccca
gagaagaggcgggggctgtacctcacagtcccccagtgtcctctggagaaaccagggtcc
ccctcaaccacccctgccccagggggtggtgcagatgacccggtgtag

DBGET integrated database retrieval system