KEGG   Pan troglodytes (chimpanzee): 454037
Entry
454037            CDS       T01005                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04114  Oocyte meiosis
ptr04140  Autophagy - animal
ptr04148  Efferocytosis
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04210  Apoptosis
ptr04218  Cellular senescence
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04350  TGF-beta signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04371  Apelin signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04520  Adherens junction
ptr04540  Gap junction
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04621  NOD-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04713  Circadian entrainment
ptr04720  Long-term potentiation
ptr04722  Neurotrophin signaling pathway
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04730  Long-term depression
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04912  GnRH signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04926  Relaxin signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr05010  Alzheimer disease
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05034  Alcoholism
ptr05132  Salmonella infection
ptr05133  Pertussis
ptr05135  Yersinia infection
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05152  Tuberculosis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05207  Chemical carcinogenesis - receptor activation
ptr05208  Chemical carcinogenesis - reactive oxygen species
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05216  Thyroid cancer
ptr05218  Melanoma
ptr05219  Bladder cancer
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    454037 (MAPK3)
   04012 ErbB signaling pathway
    454037 (MAPK3)
   04014 Ras signaling pathway
    454037 (MAPK3)
   04015 Rap1 signaling pathway
    454037 (MAPK3)
   04350 TGF-beta signaling pathway
    454037 (MAPK3)
   04370 VEGF signaling pathway
    454037 (MAPK3)
   04371 Apelin signaling pathway
    454037 (MAPK3)
   04668 TNF signaling pathway
    454037 (MAPK3)
   04066 HIF-1 signaling pathway
    454037 (MAPK3)
   04068 FoxO signaling pathway
    454037 (MAPK3)
   04072 Phospholipase D signaling pathway
    454037 (MAPK3)
   04071 Sphingolipid signaling pathway
    454037 (MAPK3)
   04024 cAMP signaling pathway
    454037 (MAPK3)
   04022 cGMP-PKG signaling pathway
    454037 (MAPK3)
   04151 PI3K-Akt signaling pathway
    454037 (MAPK3)
   04150 mTOR signaling pathway
    454037 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    454037 (MAPK3)
   04148 Efferocytosis
    454037 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    454037 (MAPK3)
   04210 Apoptosis
    454037 (MAPK3)
   04218 Cellular senescence
    454037 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    454037 (MAPK3)
   04520 Adherens junction
    454037 (MAPK3)
   04540 Gap junction
    454037 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    454037 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    454037 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    454037 (MAPK3)
   04613 Neutrophil extracellular trap formation
    454037 (MAPK3)
   04620 Toll-like receptor signaling pathway
    454037 (MAPK3)
   04621 NOD-like receptor signaling pathway
    454037 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    454037 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    454037 (MAPK3)
   04660 T cell receptor signaling pathway
    454037 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    454037 (MAPK3)
   04659 Th17 cell differentiation
    454037 (MAPK3)
   04657 IL-17 signaling pathway
    454037 (MAPK3)
   04662 B cell receptor signaling pathway
    454037 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    454037 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    454037 (MAPK3)
   04062 Chemokine signaling pathway
    454037 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    454037 (MAPK3)
   04929 GnRH secretion
    454037 (MAPK3)
   04912 GnRH signaling pathway
    454037 (MAPK3)
   04915 Estrogen signaling pathway
    454037 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    454037 (MAPK3)
   04917 Prolactin signaling pathway
    454037 (MAPK3)
   04921 Oxytocin signaling pathway
    454037 (MAPK3)
   04926 Relaxin signaling pathway
    454037 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    454037 (MAPK3)
   04919 Thyroid hormone signaling pathway
    454037 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    454037 (MAPK3)
   04916 Melanogenesis
    454037 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    454037 (MAPK3)
   04270 Vascular smooth muscle contraction
    454037 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    454037 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    454037 (MAPK3)
   04725 Cholinergic synapse
    454037 (MAPK3)
   04726 Serotonergic synapse
    454037 (MAPK3)
   04720 Long-term potentiation
    454037 (MAPK3)
   04730 Long-term depression
    454037 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    454037 (MAPK3)
   04722 Neurotrophin signaling pathway
    454037 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    454037 (MAPK3)
   04380 Osteoclast differentiation
    454037 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    454037 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    454037 (MAPK3)
   05206 MicroRNAs in cancer
    454037 (MAPK3)
   05205 Proteoglycans in cancer
    454037 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    454037 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    454037 (MAPK3)
   05203 Viral carcinogenesis
    454037 (MAPK3)
   05230 Central carbon metabolism in cancer
    454037 (MAPK3)
   05231 Choline metabolism in cancer
    454037 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    454037 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    454037 (MAPK3)
   05212 Pancreatic cancer
    454037 (MAPK3)
   05225 Hepatocellular carcinoma
    454037 (MAPK3)
   05226 Gastric cancer
    454037 (MAPK3)
   05214 Glioma
    454037 (MAPK3)
   05216 Thyroid cancer
    454037 (MAPK3)
   05221 Acute myeloid leukemia
    454037 (MAPK3)
   05220 Chronic myeloid leukemia
    454037 (MAPK3)
   05218 Melanoma
    454037 (MAPK3)
   05211 Renal cell carcinoma
    454037 (MAPK3)
   05219 Bladder cancer
    454037 (MAPK3)
   05215 Prostate cancer
    454037 (MAPK3)
   05213 Endometrial cancer
    454037 (MAPK3)
   05224 Breast cancer
    454037 (MAPK3)
   05223 Non-small cell lung cancer
    454037 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    454037 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    454037 (MAPK3)
   05161 Hepatitis B
    454037 (MAPK3)
   05160 Hepatitis C
    454037 (MAPK3)
   05171 Coronavirus disease - COVID-19
    454037 (MAPK3)
   05164 Influenza A
    454037 (MAPK3)
   05163 Human cytomegalovirus infection
    454037 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    454037 (MAPK3)
   05165 Human papillomavirus infection
    454037 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    454037 (MAPK3)
   05135 Yersinia infection
    454037 (MAPK3)
   05133 Pertussis
    454037 (MAPK3)
   05152 Tuberculosis
    454037 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    454037 (MAPK3)
   05140 Leishmaniasis
    454037 (MAPK3)
   05142 Chagas disease
    454037 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    454037 (MAPK3)
   05020 Prion disease
    454037 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    454037 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    454037 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    454037 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    454037 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    454037 (MAPK3)
   04934 Cushing syndrome
    454037 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    454037 (MAPK3)
   01524 Platinum drug resistance
    454037 (MAPK3)
   01522 Endocrine resistance
    454037 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    454037 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    454037 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    454037 (MAPK3)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     454037 (MAPK3)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   454037 (MAPK3)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     454037 (MAPK3)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   454037 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 454037
NCBI-ProteinID: XP_016784272
Ensembl: ENSPTRG00000007988
VGNC: 8987
UniProt: H2RA86 A0A6D2WMK9
LinkDB
Position
16:complement(23406192..23415411)
AA seq 379 aa
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccgtagaaccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgaacatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcagctgagcaat
gaccatatctgctatttcctctaccagatcctgcggggcctcaagtacatccactccgcc
aacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgtgatttcggcctggcccggattgccgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcccggagtgctggaggccccctag

DBGET integrated database retrieval system