KEGG   Pan troglodytes (chimpanzee): 454581Help
Entry
454581            CDS       T01005                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3 isoform X2
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03410  Base excision repair
Module
ptr_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    454581 (LIG3)
Enzymes [BR:ptr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     454581 (LIG3)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     454581 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme HD_2 Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 454581
NCBI-ProteinID: XP_003315567
Ensembl: ENSPTRG00000009008
VGNC: 9437
UniProt: H2QCN9
LinkDB All DBs
Position
17
AA seq 949 aa AA seqDB search
MSLAFKILFPQTLRALSRKELCLFRKRHWRDVRQFSQWSETDLLHGHPLFLRRKPILSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
TMKVGEKLATKSSPVKVGEKRKAADETLCQTKRRPASEQRGRTVPAGRR
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggctttcaagatcctctttccacaaaccctccgtgcactcagccgaaaagaa
ctgtgcctattccgaaaacgtcactggcgtgatgtaagacaattcagccagtggtcagaa
acagatctgcttcatggacatcccctcttcctgagaagaaagcctattctatcattccag
ggaagccatctaagatcacgtgccacctaccttgttttcttgccagggttgcatgtggga
ctctgcagtggcccctgtgagatggctgagcaacggttctgtgtggactatgccaagcgt
ggcacagctggctgcaaaaaatgcaaggaaaagattgtgaagggcgtatgccgaattggc
aaagtggtgcccaatcccttctcagagtctgggggtgatatgaaagagtggtaccacatt
aaatgcatgtttgagaaactagagcgggcccgggccaccacaaaaaaaatcgaggacctc
acagagctggaaggctgggaagagctggaagataatgagaaggaacagataacccagcac
attgcagatctgtcttctaaggcagcaggtacaccaaagaagaaagctgttgtccaggct
aagttgacaaccactggccaggtgacttctccagtgaaaggcgcctcatttgtcaccagt
accaatccccggaaattttctggcttttcagccaagcccaacaactctggggaagccccc
tcgagccccacccctaagagaagtctgtcttcaagcaaatgtgaccccaggcataaggac
tgtctgctacgggagtttcgaaagttatgcgccatggtggccgataatcctagctacaac
acgaagacccagatcatccaggacttccttcggaaaggctcagcaggagatggtttccac
ggtgatgtgtacctaacagtgaagctgctgctgccaggagtcattaagactgtttacaac
ttgaatgataagcagattgtgaagcttttcagtcgcatttttaactgcaacccagatgat
atggcacgggacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcag
agcaagtctttccccccagctgccaagagcctccttaccatccaggaagtggatgagttc
cttctgcggctgtccaagctcaccaaggaggatgagcagcaacaggccctacaggacatt
gcctccaggtgtacagccaatgaccttaaatgcatcatcaggttgatcaaacatgatctg
aagatgaactcaggtgcaaaacatgtgttagacgcccttgaccccaatgcctatgaagcc
ttcaaagcctcgcgcaacctgcaggatgtggtggagcgggtccttcacaacgcgcaggag
gtggagaaggagccgggccagagacgagctctgagcgtccaggcctcgctgatgacacct
gtgcagcccatgttggcggaggcctgcaagtccgttgagtatgcaatgaagaaatgtccc
aatggcatgttctctgagatcaagtacgatggagagcgagtccaggtgcataagaatgga
gaccacttcagctacttcagccgcagtctcaagcccgtccttcctcacaaggtggcccac
tttaaggactacattccccaggcttttcctgggggccacagcatgatcttggattctgaa
gtgcttctgattgacaacaagacaggcaaaccactgccctttgggactctgggagtgcac
aagaaagcagccttccaggatgctaatgtctgcctgtttgtttttgattgtatctacttt
aatgatgtcagcttgatggacagacctctgtgtgagcggcggaagtttcttcatgacaac
atggttgaaattccaaaccggatcatgttctcagaaatgaagcgagtcacaaaagctttg
gacttggctgacatgataacccgggtgatccaggagggattggaggggctggtgctgaag
gatgtgaagggtacatatgagcctgggaagcggcactggctgaaagtgaagaaagactat
ttgaacgagggggccatggccgacacagctgacctggtggtccttggagccttctatggg
caagggagcaaaggcggcatgatgtcaatcttcctcatgggctgctacgaccctggcagc
cagaagtggtgcacagtcaccaagtgtgcaggaggccatgatgatgccacgcttgcccgc
ctgcagaaggaactagacatggtgaagatcagcaaggaccccagcaaaatacccagctgg
ttgaaggtcaacaagatctactatcctgacttcatcgtcccagacccaaagaaagctgcc
gtgtgggagatcacaggggctgaattctccaaatcggaggctcatacagctgacgggatc
tccatccgattccctcgctgcacccgaatccgagatgataaggactggaaatctgccact
aaccttccccaactcaaggaactgtaccagttgtccaaggagaaggcagacttcactgta
gtggctggagatgaggggagctccactacagggggtagcagtgaagagaataagggtccc
tcagggtctgctgtgtcccgcaaggcccccagcaagccctcagccagtaccaagaaagca
gaagggaagctgagtaactccaacagcaaagatggcaacatgcagactgcaaagccttcc
actatgaaggtgggggagaagctggccacaaagtcttctccagtgaaagtaggggagaag
cggaaagctgctgatgagacgctgtgccaaacaaagaggcggccagccagtgagcagaga
ggaagaactgtgccagcaggcaggagatag

DBGET integrated database retrieval system