KEGG   Pan troglodytes (chimpanzee): 454641
Entry
454641            CDS       T01005                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X1
  KO
K05423  granulocyte colony-stimulating factor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04151  PI3K-Akt signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04657  IL-17 signaling pathway
ptr05144  Malaria
ptr05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    454641 (CSF3)
   04151 PI3K-Akt signaling pathway
    454641 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    454641 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    454641 (CSF3)
   04657 IL-17 signaling pathway
    454641 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    454641 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    454641 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    454641 (CSF3)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  CSF and other factors
   454641 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 IL6 NAGLU Img2
Other DBs
NCBI-GeneID: 454641
NCBI-ProteinID: XP_009430519
Ensembl: ENSPTRG00000024346
VGNC: 9417
UniProt: H2R024 A0A6D2XR64
LinkDB
Position
17
AA seq 204 aa
MAGPAAQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQ
ALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGG
VLVASHLQSFLEVSYRVLRHLAQP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctggacctgccgcccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcggcg
ctccaggagaagctgtgtgccacctacaagctgtgccaccccgaggagctggtgctgctc
ggacactctctgggcatcccctgggctcccctgagcagctgccccagccaggccctgcag
ctggcaggctgcttgagccaactccatagcggcctcttcctctaccaggggctcctgcag
gccctggaagggatctcccccgagttgggtcccaccttggacacactgcagctggatgtc
gccgactttgccaccaccatctggcagcagatggaagaactgggaatggcccctgccctg
cagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgggcaggaggg
gtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgttctacgccac
cttgcccagccctga

DBGET integrated database retrieval system