KEGG   Pan troglodytes (chimpanzee): 454832
Entry
454832            CDS       T01005                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X2
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04310  Wnt signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04510  Focal adhesion
ptr04540  Gap junction
ptr04650  Natural killer cell mediated cytotoxicity
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04713  Circadian entrainment
ptr04720  Long-term potentiation
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04727  GABAergic synapse
ptr04728  Dopaminergic synapse
ptr04730  Long-term depression
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04919  Thyroid hormone signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04929  GnRH secretion
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04961  Endocrine and other factor-regulated calcium reabsorption
ptr04970  Salivary secretion
ptr04971  Gastric acid secretion
ptr04972  Pancreatic secretion
ptr05017  Spinocerebellar ataxia
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05031  Amphetamine addiction
ptr05032  Morphine addiction
ptr05143  African trypanosomiasis
ptr05146  Amoebiasis
ptr05161  Hepatitis B
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05223  Non-small cell lung cancer
ptr05225  Hepatocellular carcinoma
ptr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    454832 (PRKCA)
   04012 ErbB signaling pathway
    454832 (PRKCA)
   04014 Ras signaling pathway
    454832 (PRKCA)
   04015 Rap1 signaling pathway
    454832 (PRKCA)
   04310 Wnt signaling pathway
    454832 (PRKCA)
   04370 VEGF signaling pathway
    454832 (PRKCA)
   04066 HIF-1 signaling pathway
    454832 (PRKCA)
   04020 Calcium signaling pathway
    454832 (PRKCA)
   04070 Phosphatidylinositol signaling system
    454832 (PRKCA)
   04072 Phospholipase D signaling pathway
    454832 (PRKCA)
   04071 Sphingolipid signaling pathway
    454832 (PRKCA)
   04151 PI3K-Akt signaling pathway
    454832 (PRKCA)
   04150 mTOR signaling pathway
    454832 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    454832 (PRKCA)
   04540 Gap junction
    454832 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    454832 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    454832 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    454832 (PRKCA)
   04670 Leukocyte transendothelial migration
    454832 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    454832 (PRKCA)
   04929 GnRH secretion
    454832 (PRKCA)
   04912 GnRH signaling pathway
    454832 (PRKCA)
   04921 Oxytocin signaling pathway
    454832 (PRKCA)
   04926 Relaxin signaling pathway
    454832 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    454832 (PRKCA)
   04918 Thyroid hormone synthesis
    454832 (PRKCA)
   04919 Thyroid hormone signaling pathway
    454832 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    454832 (PRKCA)
   04916 Melanogenesis
    454832 (PRKCA)
   04925 Aldosterone synthesis and secretion
    454832 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    454832 (PRKCA)
   04270 Vascular smooth muscle contraction
    454832 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    454832 (PRKCA)
   04971 Gastric acid secretion
    454832 (PRKCA)
   04972 Pancreatic secretion
    454832 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    454832 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    454832 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    454832 (PRKCA)
   04727 GABAergic synapse
    454832 (PRKCA)
   04725 Cholinergic synapse
    454832 (PRKCA)
   04728 Dopaminergic synapse
    454832 (PRKCA)
   04726 Serotonergic synapse
    454832 (PRKCA)
   04720 Long-term potentiation
    454832 (PRKCA)
   04730 Long-term depression
    454832 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    454832 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    454832 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    454832 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    454832 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    454832 (PRKCA)
   05206 MicroRNAs in cancer
    454832 (PRKCA)
   05205 Proteoglycans in cancer
    454832 (PRKCA)
   05231 Choline metabolism in cancer
    454832 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    454832 (PRKCA)
   05214 Glioma
    454832 (PRKCA)
   05223 Non-small cell lung cancer
    454832 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    454832 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    454832 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    454832 (PRKCA)
   05032 Morphine addiction
    454832 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    454832 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    454832 (PRKCA)
   05161 Hepatitis B
    454832 (PRKCA)
   05171 Coronavirus disease - COVID-19
    454832 (PRKCA)
   05164 Influenza A
    454832 (PRKCA)
   05163 Human cytomegalovirus infection
    454832 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    454832 (PRKCA)
   05143 African trypanosomiasis
    454832 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    454832 (PRKCA)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     454832 (PRKCA)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   454832 (PRKCA)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    454832 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 454832
NCBI-ProteinID: XP_003315734
Ensembl: ENSPTRG00000009557
VGNC: 12611
UniProt: H2QDQ1
LinkDB
Position
17
AA seq 672 aa
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMVGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccacagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccggaaggggacgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggaatatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcagcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tacagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggttggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgccgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagaacatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgcggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccgcct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

DBGET integrated database retrieval system