KEGG   Pan troglodytes (chimpanzee): 455026
Entry
455026            CDS       T01005                                 

Gene name
NOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00220  Arginine biosynthesis
ptr00330  Arginine and proline metabolism
ptr01100  Metabolic pathways
ptr04020  Calcium signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04146  Peroxisome
ptr04371  Apelin signaling pathway
ptr04926  Relaxin signaling pathway
ptr05010  Alzheimer disease
ptr05014  Amyotrophic lateral sclerosis
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05133  Pertussis
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05200  Pathways in cancer
ptr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    455026 (NOS2)
   00330 Arginine and proline metabolism
    455026 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    455026 (NOS2)
   04066 HIF-1 signaling pathway
    455026 (NOS2)
   04020 Calcium signaling pathway
    455026 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    455026 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    455026 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    455026 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    455026 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    455026 (NOS2)
   05014 Amyotrophic lateral sclerosis
    455026 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    455026 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    455026 (NOS2)
   05152 Tuberculosis
    455026 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    455026 (NOS2)
   05145 Toxoplasmosis
    455026 (NOS2)
   05140 Leishmaniasis
    455026 (NOS2)
   05142 Chagas disease
    455026 (NOS2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     455026 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 455026
NCBI-ProteinID: XP_024206443
Ensembl: ENSPTRG00000008903
VGNC: 9479
LinkDB
Position
17
AA seq 1259 aa
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSRPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACEMFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVHLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLLKLAQVATEATERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVLTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHPYREEMLEMAQKGVLHAVHTXYSRLPGKLRPLASPSLHLLSSKMLVIHNHQSDAVKS
VTPSHTAEATDLERFRTNLGHTRVNPRAQPAEGPQQAPWDTRLAGERWSRLATLKPCKAG
GRPMLPPRPSEGLFCPQGRVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMAWDVAHT
LKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQPSNLEMSAL
NT seq 3780 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaatgtggagaaagccccctgtgccacctccagaccagtgaca
caggatgaccttcagtatcacaacctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaagccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccgcagctgttccaccgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtccccctggtcctgcaggccaatggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagagagattccattgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacaggctgagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagatgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcatgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggatggccccacaccccaccagaca
gtgcacctggaggccctggatgagagtggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcacaacacccccaacccag
ctgctgctcctaaagctggcccaggtggccacagaagcgactgagagacagaggctggag
gccctttgccagccctcagagtacagcaagtggaagttcaccaacagccccacattcctg
gaggtgctagaggagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttttactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggccgtgctcacgtaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacttggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggatccctcccatccttgcatcctcatc
gggcctggcacaggcatcgcgcccttccgcagtttctggcagcaacggctccatgactcc
cagcacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacccctaccgggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacgncctattcccgcctgcctggcaagctaaggcccctcgcctccccgagcctt
cacctcctgagctcgaaaatgctggtaattcacaaccatcagagtgatgctgtgaagagc
gttacaccctctcatacagcagaagcgacagacctggagaggttcaggactaacctaggt
cacacgcgggttaaccccagagcccagcctgctgaaggtccccagcaggccccctgggac
acgcgactggccggggagaggtggtccaggctggctacgctcaagccttgcaaggctggt
gggcggccgatgcttccaccacggccatcagaggggctcttctgtccccagggccgcgtc
tatgttcaggacatcctgcggcagcagctggccagcgaggtgctccgtgtgctccacaag
gagccaggccacctctatgtttgcggggatgtgcgcatggcctgggacgtggcccacacc
ctgaagcagctggtggctgccaagctgaaattgaatgaggagcaggtcgaggactatttc
tttcagctcaagagccagaagcgctatcacgaagatatctttggtgctgtatttccctac
gaggcgaagaaggacagggtggcggtgcagcccagcaacctggagatgtcagcgctctga

DBGET integrated database retrieval system