KEGG   Pan troglodytes (chimpanzee): 455065
Entry
455065            CDS       T01005                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04620  Toll-like receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04912  GnRH signaling pathway
ptr04926  Relaxin signaling pathway
ptr04935  Growth hormone synthesis, secretion and action
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    455065 (MAP2K4)
   04012 ErbB signaling pathway
    455065 (MAP2K4)
   04668 TNF signaling pathway
    455065 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    455065 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    455065 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    455065 (MAP2K4)
   04926 Relaxin signaling pathway
    455065 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    455065 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    455065 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    455065 (MAP2K4)
   05135 Yersinia infection
    455065 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    455065 (MAP2K4)
   05161 Hepatitis B
    455065 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    455065 (MAP2K4)
   05169 Epstein-Barr virus infection
    455065 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    455065 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    455065 (MAP2K4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     455065 (MAP2K4)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   455065 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 455065
NCBI-ProteinID: XP_001163981
Ensembl: ENSPTRG00000008783
VGNC: 9364
UniProt: H2QCA7 A0A6D2Y882
LinkDB
Position
17
AA seq 410 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
cccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaa
aacccacacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatc
tcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggca
gttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttg
gatgtagtaatgcggagtagtgattgcccatacattgttcagttttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagat
atcaaaccttccaatattcttctggacagaagtggaaatattaagctctgtgacttcggc
atcagtggacagcttgtggactctattgccaagacaagagatgctggctgtaggccatac
atggcacctgaaagaatagacccaagcgcatcacgacaaggatatgatgtccgctctgat
gtctggagtttggggatcacattgtatgagttggccacaggccgatttccttatccaaag
tggaatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccgcagctgagt
aattctgaggaaagggaattctccccgagtttcatcaactttgtcaacttgtgccttacg
aaggatgaatccaaaaggccaaagtataaagagcttctgaaacatccctttattttgatg
tatgaagaacgtgccgttgaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgattga

KEGG   Pan troglodytes (chimpanzee): 743199
Entry
743199            CDS       T01005                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X3
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04012  ErbB signaling pathway
ptr04141  Protein processing in endoplasmic reticulum
ptr04380  Osteoclast differentiation
ptr04530  Tight junction
ptr04620  Toll-like receptor signaling pathway
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04668  TNF signaling pathway
ptr04722  Neurotrophin signaling pathway
ptr04912  GnRH signaling pathway
ptr04926  Relaxin signaling pathway
ptr05010  Alzheimer disease
ptr05016  Huntington disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05161  Hepatitis B
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    743199 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    743199 (MAP2K7)
   04012 ErbB signaling pathway
    743199 (MAP2K7)
   04668 TNF signaling pathway
    743199 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    743199 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    743199 (MAP2K7)
   04660 T cell receptor signaling pathway
    743199 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    743199 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    743199 (MAP2K7)
   04926 Relaxin signaling pathway
    743199 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    743199 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    743199 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    743199 (MAP2K7)
   05016 Huntington disease
    743199 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    743199 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    743199 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    743199 (MAP2K7)
   05135 Yersinia infection
    743199 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    743199 (MAP2K7)
   05161 Hepatitis B
    743199 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    743199 (MAP2K7)
   05169 Epstein-Barr virus infection
    743199 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    743199 (MAP2K7)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     743199 (MAP2K7)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE7 family
   743199 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 743199
NCBI-ProteinID: XP_001146898
Ensembl: ENSPTRG00000010409
VGNC: 7487
UniProt: A0A2I3SHE5 A0A6D2W0R9
LinkDB
Position
19
AA seq 426 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLPCPSPSQVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDF
QSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQP
HLPFFR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccctgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtttggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagcaaatgcggcgctcggggaacaaggaggagaac
aagcgcatcctcatggacctggatgtggtgctcaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggacgtcttcatcgccatggagctcatgggc
acctgcgctgaaaagctcaagaagcggatgcagggccccattcccgagcgcattctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgccggctgt
gccgcctacatggcacccgagcgcattgaccccccagaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttgccctgcccgtctccctcccaggtg
gagctggcaacaggacagtttccctacaagaactgcaagacggactttgaggtcctcacc
aaagtcctacaggaagagcccccgcttctgcccggacacatgggcttctcgggggacttc
cagtccttcgtcaaagactgccttactaaagatcacaggaagagaccaaagtataataag
ctacttgaacacagcttcatcaagcgctacgagacgctggaggtggacgtggcgtcctgg
ttcaaggatgtcatggcgaagactgagtcaccgcggactagcggcgtcctgagccagccc
cacctgcccttcttcaggtag

DBGET integrated database retrieval system