KEGG   Pan troglodytes (chimpanzee): 455425Help
Entry
455425            CDS       T01005                                 

Gene name
DCC
Definition
(RefSeq) netrin receptor DCC isoform X3
  KO
K06765  deleted in colorectal carcinoma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04360  Axon guidance
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    455425 (DCC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    455425 (DCC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    455425 (DCC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 Ig_4 Interfer-bind Ig_6 EphA2_TM Herpes_gE Protocadherin FAM176 V-set_CD47 TMEM154 CD34_antigen DUF4998 Ly49
Motif
Other DBs
NCBI-GeneID: 455425
NCBI-ProteinID: XP_009432312
Ensembl: ENSPTRG00000010031
VGNC: 13254
LinkDB All DBs
Position
18
AA seq 1445 aa AA seqDB search
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLD
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNV
TDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVP
TVNWMKNGDVVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKP
AIPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPAEAKGNIQTFTVFFSREGDNRERALNTT
QPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTS
PTSILITWEPPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLA
YNRYGPGVSTDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGEMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDL
DESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDL
STPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDT
TSLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKP
RAVIVSWQPPLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYF
RIQARNSKGVGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPI
GQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQQRKKRATHSAGK
RKGSQKDLRPPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGS
KSTSHSGQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ
YPGILPSPTCGYPHPQFTLRPVPFPTLSVDRGFGAGRTVSEGPTTQQPPMLPPSQPEHSS
SEEAPSRTIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTA
SLGLAGKARSPLLPVSVPTAPEVSEESHKPTEDSANVYEQDDLSEQMASLEGLMKQLNAI
TGSAF
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttggatgtgtttgggtacccaagctggcttttgtactcttcggagct
tccttgctcagcgcgcatcttcaagtaaccggttttcaaattaaagctttcacagcactg
cgcttcctctcagaaccttctgatgccgtcacaatgcggggaggaaatgtcctcctcgac
tgctccgcggagtctgaccgaggagttccagtgatcaagtggaagaaagatggcattcat
ctagccttgggaatggatgaaaggaagcagcaactttcaaatgggtctctgctgatacaa
aacatacttcattccagacaccacaagccagatgagggactttaccaatgtgaggcatct
ttaggagattctggctcaattattagtcggacagcaaaagttgcagtagcaggaccactg
aggttcctttcacagacagaatctgtcacagccttcatgggagacacagtgctactcaag
tgtgaagtcattggggagcccatgccaacaatccactggcagaagaaccaacaagacctg
actccaatcccaggcgactcccgagtggtggtcttgccctctggagcattgcagatcagc
cgactccaaccgggggacattggaatttaccgatgctcagctcgaaatccagccagctca
agaacaggaaatgaagcagaagtcagaattttatcagatccaggactgcatagacagctg
tattttctgcaaagaccatccaatgtagtagccattgaaggaaaagatgctgtcctggaa
tgttgtgtttctggctatcctccgccaagttttacatggttacgaggcgaggaagtcatc
caactcaggtctaaaaagtattctttattgggtggaagcaacttgcttatctccaatgtg
acagatgatgacagtggaatgtatacctgtgttgtcacatataaaaatgagaatattagt
gcctctgcagagctcacagtcttggttccgccatggtttttaaatcatccttccaacctc
tatgcctatgaaagcatggatattgagtttgaatgtacagtctctggaaagcctgtgccc
actgtgaattggatgaagaatggagatgtggtcattcctagtgattattttcagatagtg
ggaggaagcaacttacggatacttggggtggtgaagtcagatgaaggcttttatcaatgt
gtggctgaaaatgaggctggaaatgcccagaccagtgcacagctcattgtccctaagcct
gctatcccaagctccagtgtcctcccttcggctcccagagatgtggtccctgtcttggtt
tccagccgatttgtccgtctcagctggcgcccacctgcagaagcgaaagggaacattcaa
actttcacggtctttttctccagagaaggtgacaacagggaacgagcattgaatacaaca
cagcctgggtcccttcagctcactgtgggaaacctgaagccagaagccatgtacaccttt
cgagttgtggcttacaatgaatggggaccgggagagagttctcaacccatcaaggtggcc
acacagcctgagttgcaagttccagggccagtagaaaacctgcaagctgtatctacctca
cctacctcaattcttattacctgggaaccccctgcctatgcaaacggtccagtccaaggt
tacagattgttctgcactgaggtgtccacaggaaaagaacagaatatagaggttgatgga
ctatcttataaactggaaggcctgaaaaaattcaccgaatatagtcttcgattcttagct
tataatcgctatggtccgggcgtctctactgatgatataacagtggttacactttctgac
gtgccaagtgccccgcctcagaacgtctccctggaagtggtcaattcaagaagtatcaaa
gttagctggctgcctcctccatcaggaacacaaaatggatttattaccggctataaaatt
cgacacagaaagacgacccgcaggggtgagatggaaacactggagccaaacaacctctgg
tacctattcacaggactggagaaaggaagtcagtacagtttccaggtgtcagccatgaca
gtcaatggtactggaccaccttccaactggtatactgcagagactccagagaatgatcta
gatgaatctcaagttcctgatcaaccaagctctcttcatgtgaggccccagactaactgc
atcatcatgagttggactcctcccttgaacccaaacatcgtggtgcgaggttatattatc
ggttatggcgttgggagcccttacgctgagacagtgcgtgtggacagcaagcagcgatat
tattccattgagaggttagagtcaagttcccattacgtaatctccctaaaagcttttaac
aatgccggagaaggagttcctctttatgaaagtgccaccaccaggtctataacagatccc
actgacccagttgattattatcctttgcttgatgatttccccacctcggtcccagatctc
tccacccccatgctcccaccagtaggtgtacaggctgtggctcttacccatgatgctgtg
agggtcagctgggcagacaactctgtccctaagaaccaaaagacgtctgaggtgcgactt
tacaccgtccggtggagaaccagcttttctgcaagtgcaaaatacaagtcagaagacaca
acatctctaagttacacagcaacaggcctcaaaccaaacacaatgtatgaattctcggtc
atggtaacaaaaaacagaaggtccagtacttggagcatgactgcacatgccaccacgtat
gaagcagcccccacctctgctcccaaggacttgacagtcattactagggaagggaagcct
cgtgccgtcattgtgagttggcagcctcccttggaagccaatgggaaaattactgcttac
atcttattttataccttggacaagaacatcccaattgatgactggattatggaaacaatc
agtggtgataggcttactcatcaaatcatggatctcaaccttgatactatgtattacttt
cgaattcaagcacgaaattcaaaaggagtggggccactctctgatcccatcctcttcagg
actctgaaagtggaacaccctgacaaaatggctaatgaccaaggtcgtcatggagatgga
ggttattggccagttgatactaatttgattgatagaagcaccctaaatgagccgccaatt
ggacaaatgcaccccccacatggcagtgtcactcctcagaagaacagcaacctgcttgtg
atcattgtggtcaccgttggtgtcatcacagtgctggtagtggtcatcgtggctgtgatt
tgcacccgacgctcttcagcccagcagagaaagaaacgggccacccacagtgctggcaaa
aggaagggcagccagaaggacctcagaccccctgatctttggatccatcatgaagaaatg
gagatgaaaaatattgaaaagccatctggcactgaccctgcaggaagggactctcccatc
caaagttgccaagacctcacaccagtcagccacagccagtcagaaacccaactgggaagc
aaaagcacctctcattcaggtcaagatactgaggaagcagggagctctatgtccactctg
gagaggtcactggctgcacgccgagccccccgggccaagctcatgattcccatggatgcc
cagtccaacaatcctgctgtcgtgagcgccatcccggtgccaaccctagaaagtgcccag
tatccaggaatcctcccgtctcccacctgtggatatccccacccgcagttcactctccgg
cctgtgccattcccaacactctcagtggaccgaggttttggagcaggaagaacagtgagt
gaaggaccaactacccaacaaccacctatgctgcccccatctcagcctgagcattctagc
agtgaggaggcaccaagcagaaccatccccacagcttgtgttcgaccaactcatccactc
cgcagctttgctaatcctttgctacctccaccaatgagtgcaatagaaccgaaagtccct
tacacaccacttttgtctcagccagggcccactcttcctaagacccatgtgaaaacagcc
tcccttgggttggctggaaaagcaagatcccctttgcttcctgtgtctgtgccaacagcc
cctgaagtgtctgaggagagccacaaaccaacagaggattcagccaatgtgtatgaacag
gatgatctgagtgaacaaatggcaagtttggaaggactcatgaagcagcttaatgccatc
acaggctcagccttttaa

DBGET integrated database retrieval system