KEGG   Pan troglodytes (chimpanzee): 455722Help
Entry
455722            CDS       T01005                                 

Gene name
LDLR
Definition
(RefSeq) low-density lipoprotein receptor isoform X1
  KO
K12473  low-density lipoprotein receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04144  Endocytosis
ptr04913  Ovarian steroidogenesis
ptr04925  Aldosterone synthesis and secretion
ptr04927  Cortisol synthesis and secretion
ptr04934  Cushing syndrome
ptr04976  Bile secretion
ptr04979  Cholesterol metabolism
ptr05145  Toxoplasmosis
ptr05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    455722 (LDLR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    455722 (LDLR)
   04925 Aldosterone synthesis and secretion
    455722 (LDLR)
   04927 Cortisol synthesis and secretion
    455722 (LDLR)
  09154 Digestive system
   04976 Bile secretion
    455722 (LDLR)
   04979 Cholesterol metabolism
    455722 (LDLR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    455722 (LDLR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    455722 (LDLR)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    455722 (LDLR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    455722 (LDLR)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    455722 (LDLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF EGF_CA SGL EGF hEGF
Motif
Other DBs
NCBI-GeneID: 455722
NCBI-ProteinID: XP_024206933
Ensembl: ENSPTRG00000010490
VGNC: 2325
LinkDB All DBs
Position
19
AA seq 860 aa AA seqDB search
MEPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGK
CISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQHCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDE
FQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMAR
DCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQH
PDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYT
SLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLA
VDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTVLE
DEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQ
PRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVA
TQETSTVRLKVSSTAVRTQHTTTRPVPNTSRLPGATPGLTTVEIVTTSHQALGDVAGRGN
EKKPSSVRALSIILPIVLLVFLCLGAFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICR
NQDGYSYPSRQMVSLEDDVA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggagccctggggctggaaactgcgctggaccgtcgccttgctcctcgcggcggcgggg
actgcagtgggcgacagatgtgaaagaaacgagttccagtgccaagacgggaaatgcatc
tcctacaagtgggtctgtgatggcagcgctgagtgccaggatggctctgatgagtcccag
gagacatgcttgtctgtcacctgcaaatccggggacttcagctgtgggggccgtgtcaac
cgctgcattcctcagttctggaggtgcgatggccaagtggactgcgacaacggctcagac
gagcaaggctgtccccccaagacgtgctcccaggacgagtttcgctgccacgatgggaag
tgcatctctcggcagttcgtctgtgactcagaccgggactgcttggacggctcagacgag
gcctcctgcccggtgctcacctgtggccccgccagcttccagtgcaacagctccacctgc
atcccccagctgtgggcctgcgacaacgaccccgactgcgaagatggctcggatgagtgg
ccgcagcactgtaggggtctttacgtgttccaaggggacagtagcccctgctcggccttc
gagttccactgcctaagtggcgagtgcatccactccagctggcgctgtgatggtggcccc
gactgcaaggacaaatctgacgaggaaaactgcgctgtggccacctgtcgccctgacgaa
ttccagtgctctgatggaaactgcatccatggcagccggcagtgtgaccgggaatatgac
tgcaaggacatgagcgatgaagttggctgcgttaacgtgacactctgcgagggacccaac
aagttcaagtgtcacagcggtgaatgcatcaccctagacaaagtctgcaacatggctaga
gactgccgggactggtcagatgaacccatcaaagagtgcgggaccaacgaatgcttggac
aacaacggcggctgttcccacgtctgcaacgaccttaagatcggctacgagtgcctgtgc
cccgacggcttccagctggtggcccagcgaagatgcgaagatatcgatgagtgtcagcat
cccgacacctgcagccagctctgcgtgaacctggagggtggctacaagtgccagtgtgag
gaaggcttccagctggacccccacacgaaggcctgcaaggctgtgggctccatcgcctac
ctcttcttcaccaaccggcacgaggtcaggaagatgacgctggaccggagcgagtacacc
agcctcatccccaacctgaggaacgtggtcgctctggacacggaggtggccagcaataga
atctactggtctgacctgtcccagagaatgatctgcagcacccagcttgacagagcccat
ggcgtctcttcctacgacaccgtcatcagcagggacatccaggcccccgacgggctggct
gtggactggatccacagcaacatctactggaccgactctgtcctgggcactgtctccgtt
gcggataccaagggtgtgaagaggaaaacgttattcagggagaacggctccaagccaagg
gccattgtggtggatcctgttcatggcttcatgtactggactgactggggaactcccgcc
aagatcaagaaagggggcctgaacggtgtggacatctactcgctggtgactgaaaacatt
cagtggcccaatggcatcaccctagatctcctcagtggccgcctctactgggttgactcc
aaacttcactccatctcaagcatcgatgtcaacgggggcaaccggaagaccgtcttggag
gatgaaaagaggctggcccaccccttctccttggccgtctttgaggacaaagtattttgg
acagatatcatcaacgaagccattttcagtgccaaccgcctcacaggttccgatgtcaac
ttgttggctgaaaacctactgtccccagaggatatggtcctcttccacaacctcacccag
ccaagaggagtgaactggtgtgagaggaccaccctgagcaacggcggctgccagtatctg
tgcctccctgccccgcagatcaacccccactcgcccaagtttacctgcgcctgcccggat
ggcatgctgctggccagggacatgagaagctgcctcacagaggctgaggctgcagtggcc
acccaggagacatccaccgtcaggctaaaggtcagctccacagccgtaaggacacagcac
acaaccacccggcctgttcccaacacctcccggctgcctggggccacccctgggctcacc
acggtggagatagtgacaacatctcaccaagctctgggcgacgttgctggcagaggaaat
gagaagaagcccagtagcgtgagggctctgtccatcattctccccatcgtgctcctcgtc
ttcctctgcctgggggccttcctcctgtggaagaactggcggcttaagaacatcaacagc
atcaactttgacaaccccgtctatcagaagaccacagaggatgaggtccacatttgccgc
aaccaggacggctacagctacccctcgagacagatggtcagtctggaggatgatgtggcg
tga

DBGET integrated database retrieval system