KEGG   Pan troglodytes (chimpanzee): 455855
Entry
455855            CDS       T01005                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05100  Bacterial invasion of epithelial cells
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    455855 (PIK3R2)
   04014 Ras signaling pathway
    455855 (PIK3R2)
   04015 Rap1 signaling pathway
    455855 (PIK3R2)
   04370 VEGF signaling pathway
    455855 (PIK3R2)
   04630 JAK-STAT signaling pathway
    455855 (PIK3R2)
   04668 TNF signaling pathway
    455855 (PIK3R2)
   04066 HIF-1 signaling pathway
    455855 (PIK3R2)
   04068 FoxO signaling pathway
    455855 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    455855 (PIK3R2)
   04072 Phospholipase D signaling pathway
    455855 (PIK3R2)
   04071 Sphingolipid signaling pathway
    455855 (PIK3R2)
   04024 cAMP signaling pathway
    455855 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    455855 (PIK3R2)
   04152 AMPK signaling pathway
    455855 (PIK3R2)
   04150 mTOR signaling pathway
    455855 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    455855 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    455855 (PIK3R2)
   04218 Cellular senescence
    455855 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    455855 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    455855 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    455855 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    455855 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    455855 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    455855 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    455855 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    455855 (PIK3R2)
   04660 T cell receptor signaling pathway
    455855 (PIK3R2)
   04662 B cell receptor signaling pathway
    455855 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    455855 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    455855 (PIK3R2)
   04670 Leukocyte transendothelial migration
    455855 (PIK3R2)
   04062 Chemokine signaling pathway
    455855 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    455855 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    455855 (PIK3R2)
   04929 GnRH secretion
    455855 (PIK3R2)
   04915 Estrogen signaling pathway
    455855 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    455855 (PIK3R2)
   04917 Prolactin signaling pathway
    455855 (PIK3R2)
   04926 Relaxin signaling pathway
    455855 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    455855 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    455855 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    455855 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    455855 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    455855 (PIK3R2)
   04722 Neurotrophin signaling pathway
    455855 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    455855 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    455855 (PIK3R2)
   04380 Osteoclast differentiation
    455855 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    455855 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    455855 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    455855 (PIK3R2)
   05206 MicroRNAs in cancer
    455855 (PIK3R2)
   05205 Proteoglycans in cancer
    455855 (PIK3R2)
   05203 Viral carcinogenesis
    455855 (PIK3R2)
   05230 Central carbon metabolism in cancer
    455855 (PIK3R2)
   05231 Choline metabolism in cancer
    455855 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    455855 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    455855 (PIK3R2)
   05212 Pancreatic cancer
    455855 (PIK3R2)
   05225 Hepatocellular carcinoma
    455855 (PIK3R2)
   05226 Gastric cancer
    455855 (PIK3R2)
   05214 Glioma
    455855 (PIK3R2)
   05221 Acute myeloid leukemia
    455855 (PIK3R2)
   05220 Chronic myeloid leukemia
    455855 (PIK3R2)
   05218 Melanoma
    455855 (PIK3R2)
   05211 Renal cell carcinoma
    455855 (PIK3R2)
   05215 Prostate cancer
    455855 (PIK3R2)
   05213 Endometrial cancer
    455855 (PIK3R2)
   05224 Breast cancer
    455855 (PIK3R2)
   05222 Small cell lung cancer
    455855 (PIK3R2)
   05223 Non-small cell lung cancer
    455855 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    455855 (PIK3R2)
   05017 Spinocerebellar ataxia
    455855 (PIK3R2)
   05020 Prion disease
    455855 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    455855 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    455855 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    455855 (PIK3R2)
   04931 Insulin resistance
    455855 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    455855 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    455855 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    455855 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    455855 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    455855 (PIK3R2)
   05161 Hepatitis B
    455855 (PIK3R2)
   05160 Hepatitis C
    455855 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    455855 (PIK3R2)
   05164 Influenza A
    455855 (PIK3R2)
   05162 Measles
    455855 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    455855 (PIK3R2)
   05163 Human cytomegalovirus infection
    455855 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    455855 (PIK3R2)
   05169 Epstein-Barr virus infection
    455855 (PIK3R2)
   05165 Human papillomavirus infection
    455855 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    455855 (PIK3R2)
   05142 Chagas disease
    455855 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    455855 (PIK3R2)
   01524 Platinum drug resistance
    455855 (PIK3R2)
   01522 Endocrine resistance
    455855 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    455855 (PIK3R2)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    455855 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 455855
NCBI-ProteinID: XP_512509
Ensembl: ENSPTRG00000010694
VGNC: 13305
UniProt: H2QFS6 A0A6D2W4W8
LinkDB
Position
19
AA seq 728 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLA
LPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARRAPALG
PAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPP
ALPPKPPKAKPAPTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSK
IQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTR
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTA
IEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRT
KLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNE
TEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVV
VDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPG
PGPPPAAR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggcgggccctgagggcttccagtaccgcgctctgtacccgttccgccgggagcggccg
gaggacctggagctgctgcccggcgacgtgctggtagtgagccgggcggccttgcaggcg
ctgggcgtggccgagggtggcgagcgctgcccacagagcgtgggctggatgcccggcctc
aacgagcgcacacggcagcgaggtgacttccctggcacctatgtggagttcctggggccc
gtggccctggcccggcccggccctcgcccacggggcccccgcccactgcccgccaggccc
cgtgatggggcccctgagccaggcctcacactccccgacttgcccgagcagttctcccca
cctgatgtggctccccctcttctggtgaagcttgtggaggccattgaaaggacagggctg
gacagcgaatctcactaccgcccggagctgcccgcaccgcgtacagactggtccctgagc
gacgtggatcagtgggacacggcagccctggctgacggcattaagagcttcctgctggca
ctgcccgcgccgctcgtgacccccgaggcctcggccgaggcgcgccgggccctgcgggag
gccgcggggcccgtggggccggcgctggagccaccgacgctgccgctgcaccgcgcgctc
acgctgcgcttcctgctccagcacctgggccgcgtggcccgccgcgccccggccctgggt
cccgcggtccgggccctgggcgccacctttgggccgctgctgctgcgcgcgccgccgccg
ccgtcctcgccgccgccagggggcgctcccgacgggagtgagcccagccctgacttcccg
gcgctgctggtggagaagctgcttcaggaacacttggaagagcaggaggttgcgccccca
gcgctgccgcctaaaccccccaaggcaaagccggcccccacagtcctggccaatggaggg
agcccaccctccctgcaggatgctgagtggtactggggggacatttcaagggaggaggtg
aacgagaaactccgggacactcccgatggcaccttcctagtccgagatgcttctagcaag
atccagggcgagtacacgctgaccctcaggaaaggcgggaacaataagctgatcaaggtc
ttccaccgagatgggcactatggcttctcagagccactcaccttctgctccgttgtggac
ctcatcaatcactaccgccacgagtctctggcccagtacaacgccaagctggacacacgg
ctcctctaccctgtgtccaaataccagcaggaccagattgtcaaggaggacagcgtggag
gcagtgggcgcccagcttaaggtctatcaccagcagtaccaggacaagagccgcgagtat
gaccagctttatgaagagtacacacggacctcccaggagctgcagatgaagcgtactgca
attgaggccttcaatgagactatcaagatctttgaagagcagggccagactcaagagaaa
tgcagcaaggaatacctggagcgcttccggcgtgagggcaacgagaaagagatgcaaagg
atcctgctgaactccgagcggctcaagtcccgcattgccgagatccatgagagccgcacg
aagctggagcagcagctgcgggcccaggcctcggacaacagagagatcgacaagcgcatg
aacagcctcaagccggacctcatgcagctgcgcaagatccgagaccagtacctcgtgtgg
ctcacccagaaaggcgcccggcagaagaaaatcaacgagtggctggggattaaaaatgag
actgaggaccagtacgcactcatggaggacgaggacgatctcccgcaccacgaggaacgc
acttggtacgtgggcaagatcaaccgcacgcaggcagaggagatgttgagcggcaagcgg
gatggcaccttcctcatccgcgagagcagccagcggggctgctacgcctgctccgtggta
gtggacggcgacaccaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcg
gagccctacaacctgtacgggtcgctgaaggagctggtgctgcactaccagcacgcctcg
ctggtgcagcacaacgacgcgctcaccgtcaccctggcgcacccagtgcgcgccccgggc
cccggcccgccgcctgccgcccgctga

KEGG   Pan troglodytes (chimpanzee): 456565
Entry
456565            CDS       T01005                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05100  Bacterial invasion of epithelial cells
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    456565 (PIK3R3)
   04014 Ras signaling pathway
    456565 (PIK3R3)
   04015 Rap1 signaling pathway
    456565 (PIK3R3)
   04370 VEGF signaling pathway
    456565 (PIK3R3)
   04630 JAK-STAT signaling pathway
    456565 (PIK3R3)
   04668 TNF signaling pathway
    456565 (PIK3R3)
   04066 HIF-1 signaling pathway
    456565 (PIK3R3)
   04068 FoxO signaling pathway
    456565 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    456565 (PIK3R3)
   04072 Phospholipase D signaling pathway
    456565 (PIK3R3)
   04071 Sphingolipid signaling pathway
    456565 (PIK3R3)
   04024 cAMP signaling pathway
    456565 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    456565 (PIK3R3)
   04152 AMPK signaling pathway
    456565 (PIK3R3)
   04150 mTOR signaling pathway
    456565 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    456565 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    456565 (PIK3R3)
   04218 Cellular senescence
    456565 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    456565 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    456565 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    456565 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    456565 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    456565 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    456565 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    456565 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    456565 (PIK3R3)
   04660 T cell receptor signaling pathway
    456565 (PIK3R3)
   04662 B cell receptor signaling pathway
    456565 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    456565 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    456565 (PIK3R3)
   04670 Leukocyte transendothelial migration
    456565 (PIK3R3)
   04062 Chemokine signaling pathway
    456565 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    456565 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    456565 (PIK3R3)
   04929 GnRH secretion
    456565 (PIK3R3)
   04915 Estrogen signaling pathway
    456565 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    456565 (PIK3R3)
   04917 Prolactin signaling pathway
    456565 (PIK3R3)
   04926 Relaxin signaling pathway
    456565 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    456565 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    456565 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    456565 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    456565 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    456565 (PIK3R3)
   04722 Neurotrophin signaling pathway
    456565 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    456565 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    456565 (PIK3R3)
   04380 Osteoclast differentiation
    456565 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    456565 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    456565 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    456565 (PIK3R3)
   05206 MicroRNAs in cancer
    456565 (PIK3R3)
   05205 Proteoglycans in cancer
    456565 (PIK3R3)
   05203 Viral carcinogenesis
    456565 (PIK3R3)
   05230 Central carbon metabolism in cancer
    456565 (PIK3R3)
   05231 Choline metabolism in cancer
    456565 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    456565 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    456565 (PIK3R3)
   05212 Pancreatic cancer
    456565 (PIK3R3)
   05225 Hepatocellular carcinoma
    456565 (PIK3R3)
   05226 Gastric cancer
    456565 (PIK3R3)
   05214 Glioma
    456565 (PIK3R3)
   05221 Acute myeloid leukemia
    456565 (PIK3R3)
   05220 Chronic myeloid leukemia
    456565 (PIK3R3)
   05218 Melanoma
    456565 (PIK3R3)
   05211 Renal cell carcinoma
    456565 (PIK3R3)
   05215 Prostate cancer
    456565 (PIK3R3)
   05213 Endometrial cancer
    456565 (PIK3R3)
   05224 Breast cancer
    456565 (PIK3R3)
   05222 Small cell lung cancer
    456565 (PIK3R3)
   05223 Non-small cell lung cancer
    456565 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    456565 (PIK3R3)
   05017 Spinocerebellar ataxia
    456565 (PIK3R3)
   05020 Prion disease
    456565 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    456565 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    456565 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    456565 (PIK3R3)
   04931 Insulin resistance
    456565 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    456565 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    456565 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    456565 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    456565 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    456565 (PIK3R3)
   05161 Hepatitis B
    456565 (PIK3R3)
   05160 Hepatitis C
    456565 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    456565 (PIK3R3)
   05164 Influenza A
    456565 (PIK3R3)
   05162 Measles
    456565 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    456565 (PIK3R3)
   05163 Human cytomegalovirus infection
    456565 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    456565 (PIK3R3)
   05169 Epstein-Barr virus infection
    456565 (PIK3R3)
   05165 Human papillomavirus infection
    456565 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    456565 (PIK3R3)
   05142 Chagas disease
    456565 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    456565 (PIK3R3)
   01524 Platinum drug resistance
    456565 (PIK3R3)
   01522 Endocrine resistance
    456565 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    456565 (PIK3R3)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    456565 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Cupin_8 Mod_r Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 456565
NCBI-ProteinID: XP_016817599
Ensembl: ENSPTRG00000000685
VGNC: 11765
LinkDB
Position
1
AA seq 417 aa
MTSAVPNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTL
RKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQ
QDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK
IFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQ
ALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFIN
EEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHC
VIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgacttcagcagttccaaatggaatgaaggacagttctgtttctcttcaggatgcagaa
tggtactggggggatatttcaagggaggaggtaaatgacaaattgcgggatatgccagat
gggaccttcttggtccgagatgcctcaacaaaaatgcagggagattatactttgactttg
cggaagggaggcaataataagttaataaagatctatcaccgggatggtaaatatggcttt
tctgatcctctgacatttaattccgtggtggagctcattaaccactatcaccatgaatct
cttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtgtccagataccaa
caggatcagttggtaaaagaagataatattgatgcagtaggtaaaaaactgcaagaatac
cactctcagtatcaggagaagagtaaagagtatgataggctgtatgaagaatatactaga
acatcccaggaaatacagatgaagaggactgcaatagaagcttttaatgaaacaattaaa
atatttgaagagcagtgtcacacacaagaacaacatagcaaagaatatattgagcgattt
cgcagagaggggaatgaaaaggagattgaacgaattatgatgaattatgataaattgaaa
tcacgtctgggagagattcatgatagcaaaatgcgtctagagcaggatttgaagaaacaa
gctttggacaaccgagaaatagataaaaaaatgaatagtatcaaacctgacctgatccag
ctgcgaaagatccgagatcaacaccttgtatggctcaatcacaaaggagtgagacagaaa
cgcctgaatgtctggctgggaattaagaatgaggatgctgatgagaactattttatcaat
gaggaagatgaaaacctgccccattatgatgagaaaacctggtttgttgaggatatcaat
cgagtacaagcagaggacttgctttatgggaaacctgatggtgcattcttaattcgtgag
agtagcaagaaaggatgctatgcttgctctgtggtggccgatggggaagtgaagcactgt
gtgatctacagcactgctcggggctatggctttgcagagccctacaacctgtacagctct
ctgaaggagctagtgctccattaccagcagacatccttggttcagcacaacgactccctc
aacgtcaggcttgcctaccctgttcatgcacagatgccctcgctttgcagataa

KEGG   Pan troglodytes (chimpanzee): 457922
Entry
457922            CDS       T01005                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05100  Bacterial invasion of epithelial cells
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    457922 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    457922 (PIK3CD)
   04014 Ras signaling pathway
    457922 (PIK3CD)
   04015 Rap1 signaling pathway
    457922 (PIK3CD)
   04370 VEGF signaling pathway
    457922 (PIK3CD)
   04630 JAK-STAT signaling pathway
    457922 (PIK3CD)
   04668 TNF signaling pathway
    457922 (PIK3CD)
   04066 HIF-1 signaling pathway
    457922 (PIK3CD)
   04068 FoxO signaling pathway
    457922 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    457922 (PIK3CD)
   04072 Phospholipase D signaling pathway
    457922 (PIK3CD)
   04071 Sphingolipid signaling pathway
    457922 (PIK3CD)
   04024 cAMP signaling pathway
    457922 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    457922 (PIK3CD)
   04152 AMPK signaling pathway
    457922 (PIK3CD)
   04150 mTOR signaling pathway
    457922 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    457922 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    457922 (PIK3CD)
   04218 Cellular senescence
    457922 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    457922 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    457922 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    457922 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    457922 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    457922 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    457922 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    457922 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    457922 (PIK3CD)
   04660 T cell receptor signaling pathway
    457922 (PIK3CD)
   04662 B cell receptor signaling pathway
    457922 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    457922 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    457922 (PIK3CD)
   04670 Leukocyte transendothelial migration
    457922 (PIK3CD)
   04062 Chemokine signaling pathway
    457922 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    457922 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    457922 (PIK3CD)
   04929 GnRH secretion
    457922 (PIK3CD)
   04915 Estrogen signaling pathway
    457922 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    457922 (PIK3CD)
   04917 Prolactin signaling pathway
    457922 (PIK3CD)
   04926 Relaxin signaling pathway
    457922 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    457922 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    457922 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    457922 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    457922 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    457922 (PIK3CD)
   04722 Neurotrophin signaling pathway
    457922 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    457922 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    457922 (PIK3CD)
   04380 Osteoclast differentiation
    457922 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    457922 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    457922 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    457922 (PIK3CD)
   05206 MicroRNAs in cancer
    457922 (PIK3CD)
   05205 Proteoglycans in cancer
    457922 (PIK3CD)
   05203 Viral carcinogenesis
    457922 (PIK3CD)
   05230 Central carbon metabolism in cancer
    457922 (PIK3CD)
   05231 Choline metabolism in cancer
    457922 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    457922 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    457922 (PIK3CD)
   05212 Pancreatic cancer
    457922 (PIK3CD)
   05225 Hepatocellular carcinoma
    457922 (PIK3CD)
   05226 Gastric cancer
    457922 (PIK3CD)
   05214 Glioma
    457922 (PIK3CD)
   05221 Acute myeloid leukemia
    457922 (PIK3CD)
   05220 Chronic myeloid leukemia
    457922 (PIK3CD)
   05218 Melanoma
    457922 (PIK3CD)
   05211 Renal cell carcinoma
    457922 (PIK3CD)
   05215 Prostate cancer
    457922 (PIK3CD)
   05213 Endometrial cancer
    457922 (PIK3CD)
   05224 Breast cancer
    457922 (PIK3CD)
   05222 Small cell lung cancer
    457922 (PIK3CD)
   05223 Non-small cell lung cancer
    457922 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    457922 (PIK3CD)
   05017 Spinocerebellar ataxia
    457922 (PIK3CD)
   05020 Prion disease
    457922 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    457922 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    457922 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    457922 (PIK3CD)
   04931 Insulin resistance
    457922 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    457922 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    457922 (PIK3CD)
   05135 Yersinia infection
    457922 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    457922 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    457922 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    457922 (PIK3CD)
   05161 Hepatitis B
    457922 (PIK3CD)
   05160 Hepatitis C
    457922 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    457922 (PIK3CD)
   05164 Influenza A
    457922 (PIK3CD)
   05162 Measles
    457922 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    457922 (PIK3CD)
   05163 Human cytomegalovirus infection
    457922 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    457922 (PIK3CD)
   05169 Epstein-Barr virus infection
    457922 (PIK3CD)
   05165 Human papillomavirus infection
    457922 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    457922 (PIK3CD)
   05142 Chagas disease
    457922 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    457922 (PIK3CD)
   01524 Platinum drug resistance
    457922 (PIK3CD)
   01522 Endocrine resistance
    457922 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    457922 (PIK3CD)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     457922 (PIK3CD)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    457922 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 457922
NCBI-ProteinID: XP_016809158
Ensembl: ENSPTRG00000000120
VGNC: 8092
UniProt: K7BKN5 A0A6D2YC34
LinkDB
Position
1
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccgctcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacagcggagcagcaa
gagctggaggacgagcaacggcgtctgtgtgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgtgagggcgaccgcgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgc
gccaagatgtgccaattctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagtttccccctgcagctggagccctcggctcgaacctgggggcct
ggcaccctgcggctcccgaaccgggcccttctggtcaacgttaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggttgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaggtccagaaaccgcgt
gccaaaccacctcccattcctgcgaagaagccttcctctgtgtccctgtggtccctggag
cagccgttccgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggccgggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgctttgcgctgtacgccgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagaccggggaacgctgcctctat
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacgggcactgtgcgc
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcccgaggtggccccg
caccccgtgtactaccctgccctggagaagatcttggagctggggcgacacagcgagtgt
gtgcatgtcactgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtatgagcacgagaaggacctggtgtggaagctgcggcatgaagtccaggag
cacttcccggaggcgctagcccggctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcccgtcctgagcgccctg
gagctgctagacttcagcttccccgattgccacgtaggctccttcgccatcaagtcgctg
aggaaactgacggacgatgagctgttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcctggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaatgacttcgtcaag
ctgagctctcagaagacccccaagccccagaccaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagtggcggcagcgtgggcatcatctttaagaac
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgttcagacaccatcgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggacgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctattgtgtggccacatatgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaacggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tccctggcactggggaaaacagaggaggaggcactgaagcacttccgagtgaagtttaac
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

KEGG   Pan troglodytes (chimpanzee): 460858
Entry
460858            CDS       T01005                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05100  Bacterial invasion of epithelial cells
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    460858 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    460858 (PIK3CA)
   04014 Ras signaling pathway
    460858 (PIK3CA)
   04015 Rap1 signaling pathway
    460858 (PIK3CA)
   04370 VEGF signaling pathway
    460858 (PIK3CA)
   04630 JAK-STAT signaling pathway
    460858 (PIK3CA)
   04668 TNF signaling pathway
    460858 (PIK3CA)
   04066 HIF-1 signaling pathway
    460858 (PIK3CA)
   04068 FoxO signaling pathway
    460858 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    460858 (PIK3CA)
   04072 Phospholipase D signaling pathway
    460858 (PIK3CA)
   04071 Sphingolipid signaling pathway
    460858 (PIK3CA)
   04024 cAMP signaling pathway
    460858 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    460858 (PIK3CA)
   04152 AMPK signaling pathway
    460858 (PIK3CA)
   04150 mTOR signaling pathway
    460858 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    460858 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    460858 (PIK3CA)
   04218 Cellular senescence
    460858 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    460858 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    460858 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    460858 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    460858 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    460858 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    460858 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    460858 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    460858 (PIK3CA)
   04660 T cell receptor signaling pathway
    460858 (PIK3CA)
   04662 B cell receptor signaling pathway
    460858 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    460858 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    460858 (PIK3CA)
   04670 Leukocyte transendothelial migration
    460858 (PIK3CA)
   04062 Chemokine signaling pathway
    460858 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    460858 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    460858 (PIK3CA)
   04929 GnRH secretion
    460858 (PIK3CA)
   04915 Estrogen signaling pathway
    460858 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    460858 (PIK3CA)
   04917 Prolactin signaling pathway
    460858 (PIK3CA)
   04926 Relaxin signaling pathway
    460858 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    460858 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    460858 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    460858 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    460858 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    460858 (PIK3CA)
   04722 Neurotrophin signaling pathway
    460858 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    460858 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    460858 (PIK3CA)
   04380 Osteoclast differentiation
    460858 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    460858 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    460858 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    460858 (PIK3CA)
   05206 MicroRNAs in cancer
    460858 (PIK3CA)
   05205 Proteoglycans in cancer
    460858 (PIK3CA)
   05203 Viral carcinogenesis
    460858 (PIK3CA)
   05230 Central carbon metabolism in cancer
    460858 (PIK3CA)
   05231 Choline metabolism in cancer
    460858 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    460858 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    460858 (PIK3CA)
   05212 Pancreatic cancer
    460858 (PIK3CA)
   05225 Hepatocellular carcinoma
    460858 (PIK3CA)
   05226 Gastric cancer
    460858 (PIK3CA)
   05214 Glioma
    460858 (PIK3CA)
   05221 Acute myeloid leukemia
    460858 (PIK3CA)
   05220 Chronic myeloid leukemia
    460858 (PIK3CA)
   05218 Melanoma
    460858 (PIK3CA)
   05211 Renal cell carcinoma
    460858 (PIK3CA)
   05215 Prostate cancer
    460858 (PIK3CA)
   05213 Endometrial cancer
    460858 (PIK3CA)
   05224 Breast cancer
    460858 (PIK3CA)
   05222 Small cell lung cancer
    460858 (PIK3CA)
   05223 Non-small cell lung cancer
    460858 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    460858 (PIK3CA)
   05017 Spinocerebellar ataxia
    460858 (PIK3CA)
   05020 Prion disease
    460858 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    460858 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    460858 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    460858 (PIK3CA)
   04931 Insulin resistance
    460858 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    460858 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    460858 (PIK3CA)
   05135 Yersinia infection
    460858 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    460858 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    460858 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    460858 (PIK3CA)
   05161 Hepatitis B
    460858 (PIK3CA)
   05160 Hepatitis C
    460858 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    460858 (PIK3CA)
   05164 Influenza A
    460858 (PIK3CA)
   05162 Measles
    460858 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    460858 (PIK3CA)
   05163 Human cytomegalovirus infection
    460858 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    460858 (PIK3CA)
   05169 Epstein-Barr virus infection
    460858 (PIK3CA)
   05165 Human papillomavirus infection
    460858 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    460858 (PIK3CA)
   05142 Chagas disease
    460858 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    460858 (PIK3CA)
   01524 Platinum drug resistance
    460858 (PIK3CA)
   01522 Endocrine resistance
    460858 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    460858 (PIK3CA)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     460858 (PIK3CA)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    460858 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 460858
NCBI-ProteinID: XP_024211590
Ensembl: ENSPTRG00000015642
VGNC: 7083
LinkDB
Position
3
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataaccataaagcatgaactatttaaagaagcaagaaaataccccctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttactcaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaacgtttgtaaagaagctgtggatcttagggacctcaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaattgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatctgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtaccagaacaagta
attgctgaagcaatcaggaagaaaactcgaagtatgttgctatcctctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgttgatggctaaagaaagcctttattctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatttccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctacgtgaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgctctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcatggggaaatataaacttgtttgattacacagacactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagctattcccacgcaggactgagtaacagactagctagagac
aatgaattaagggaaaatgacaaagaacagctcaaagcaatttctacacgagatcctctc
tctgaaatcactgagcaggagaaagattttctatggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gcccagatgtattgcttggtaaaagattggcctccaatcaaacctgaacaggctatggaa
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtatttaattcagctagtacaggtcctaaaa
tatgaacaatatttggataacttgcttgtgagatttttactgaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agccagaggtttggcctgcttttggagtcctattgtcgtgcatgtgggatgtatttgaag
cacctgaataggcaagtcgaggcaatggaaaagctcattaacttaactgacattctcaaa
caggagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgagg
cgaccagatttcatggatgctctacagggctttctgtctcctctaaaccctgctcatcaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactgtttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgtattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcaaatt
cagtgcaaaggcggcttgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgtttacacgttca
tgtgctggatactgtgtagctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggtgaaagacgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagaacgtgtgccatttgttttgacacaggatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcgacagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgacattgca
tacattcgaaagaccctagccttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaaacagcatgcattgaactga

KEGG   Pan troglodytes (chimpanzee): 461836
Entry
461836            CDS       T01005                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05100  Bacterial invasion of epithelial cells
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    461836 (PIK3R1)
   04014 Ras signaling pathway
    461836 (PIK3R1)
   04015 Rap1 signaling pathway
    461836 (PIK3R1)
   04370 VEGF signaling pathway
    461836 (PIK3R1)
   04630 JAK-STAT signaling pathway
    461836 (PIK3R1)
   04668 TNF signaling pathway
    461836 (PIK3R1)
   04066 HIF-1 signaling pathway
    461836 (PIK3R1)
   04068 FoxO signaling pathway
    461836 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    461836 (PIK3R1)
   04072 Phospholipase D signaling pathway
    461836 (PIK3R1)
   04071 Sphingolipid signaling pathway
    461836 (PIK3R1)
   04024 cAMP signaling pathway
    461836 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    461836 (PIK3R1)
   04152 AMPK signaling pathway
    461836 (PIK3R1)
   04150 mTOR signaling pathway
    461836 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    461836 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    461836 (PIK3R1)
   04218 Cellular senescence
    461836 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    461836 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    461836 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    461836 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    461836 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    461836 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    461836 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    461836 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    461836 (PIK3R1)
   04660 T cell receptor signaling pathway
    461836 (PIK3R1)
   04662 B cell receptor signaling pathway
    461836 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    461836 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    461836 (PIK3R1)
   04670 Leukocyte transendothelial migration
    461836 (PIK3R1)
   04062 Chemokine signaling pathway
    461836 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    461836 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    461836 (PIK3R1)
   04929 GnRH secretion
    461836 (PIK3R1)
   04915 Estrogen signaling pathway
    461836 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    461836 (PIK3R1)
   04917 Prolactin signaling pathway
    461836 (PIK3R1)
   04926 Relaxin signaling pathway
    461836 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    461836 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    461836 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    461836 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    461836 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    461836 (PIK3R1)
   04722 Neurotrophin signaling pathway
    461836 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    461836 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    461836 (PIK3R1)
   04380 Osteoclast differentiation
    461836 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    461836 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    461836 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    461836 (PIK3R1)
   05206 MicroRNAs in cancer
    461836 (PIK3R1)
   05205 Proteoglycans in cancer
    461836 (PIK3R1)
   05203 Viral carcinogenesis
    461836 (PIK3R1)
   05230 Central carbon metabolism in cancer
    461836 (PIK3R1)
   05231 Choline metabolism in cancer
    461836 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    461836 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    461836 (PIK3R1)
   05212 Pancreatic cancer
    461836 (PIK3R1)
   05225 Hepatocellular carcinoma
    461836 (PIK3R1)
   05226 Gastric cancer
    461836 (PIK3R1)
   05214 Glioma
    461836 (PIK3R1)
   05221 Acute myeloid leukemia
    461836 (PIK3R1)
   05220 Chronic myeloid leukemia
    461836 (PIK3R1)
   05218 Melanoma
    461836 (PIK3R1)
   05211 Renal cell carcinoma
    461836 (PIK3R1)
   05215 Prostate cancer
    461836 (PIK3R1)
   05213 Endometrial cancer
    461836 (PIK3R1)
   05224 Breast cancer
    461836 (PIK3R1)
   05222 Small cell lung cancer
    461836 (PIK3R1)
   05223 Non-small cell lung cancer
    461836 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    461836 (PIK3R1)
   05017 Spinocerebellar ataxia
    461836 (PIK3R1)
   05020 Prion disease
    461836 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    461836 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    461836 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    461836 (PIK3R1)
   04931 Insulin resistance
    461836 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    461836 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    461836 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    461836 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    461836 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    461836 (PIK3R1)
   05161 Hepatitis B
    461836 (PIK3R1)
   05160 Hepatitis C
    461836 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    461836 (PIK3R1)
   05164 Influenza A
    461836 (PIK3R1)
   05162 Measles
    461836 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    461836 (PIK3R1)
   05163 Human cytomegalovirus infection
    461836 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    461836 (PIK3R1)
   05169 Epstein-Barr virus infection
    461836 (PIK3R1)
   05165 Human papillomavirus infection
    461836 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    461836 (PIK3R1)
   05142 Chagas disease
    461836 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    461836 (PIK3R1)
   01524 Platinum drug resistance
    461836 (PIK3R1)
   01522 Endocrine resistance
    461836 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    461836 (PIK3R1)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    461836 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Laminin_I DUF4201 Lant_dehydr_C Mod_r Bap31_Bap29_C PI_PP_I Transcrip_act
Other DBs
NCBI-GeneID: 461836
NCBI-ProteinID: XP_003950591
Ensembl: ENSPTRG00000016940
VGNC: 13565
UniProt: H2QR04 A0A6D2VYT9
LinkDB
Position
5
AA seq 454 aa
MYNTVWNMEDLDLEYAKTDINCGTDLMFYIEMDPPALPPKPPKPTTVANNGMNNNMSLQD
AEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKY
GFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH
EYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDL
IQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSS
LKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtacaatactgtttggaatatggaagacctggatttagaatatgccaagacagatata
aattgtggcacagacttgatgttttatatagaaatggacccaccagcactgcctcctaaa
ccaccaaaacccactactgtagccaacaacggtatgaataacaatatgtccttacaagat
gctgaatggtactggggagatatctcgagggaagaagtgaatgaaaaacttcgagataca
gcagacgggacctttttggtacgagatgcgtctactaaaatgcatggtgattatactctt
acactaaggaaagggggaaataacaaattaatcaaaatatttcatcgagatgggaaatat
ggcttctctgacccattaaccttcaattctgtggttgaattaataaaccactaccggaat
gaatctctagctcagtataatcccaaattggatgtgaaattactttatccagtatccaaa
taccaacaggatcaagttgtcaaagaagataatattgaagctgtagggaaaaaattacat
gaatataacactcagtttcaagaaaaaagtcgagaatatgatagattatatgaagaatat
acccgcacatcccaggaaatccaaatgaaaaggacagctattgaagcatttaatgaaacc
ataaaaatatttgaagaacagtgccagacccaagagcggtacagcaaagaatacatagaa
aagtttaaacgtgaaggcaatgagaaagaaatacaaaggattatgcataattatgataag
ttgaagtctcgaatcagtgaaattattgacagtagaagaagattggaagaagacttgaag
aagcaggcagctgagtatcgagaaattgacaaacgtatgaacagcattaaaccagacctt
atccagctgagaaagacgagagaccaatacttgatgtggttgactcaaaaaggtgttcgg
caaaagaagttgaacgagtggttgggcaatgaaaacactgaagaccaatattcactggtg
gaagatgatgaagatttgccccatcatgatgagaagacatggaatgttggaagcagcaac
cgaaacaaagctgaaaacctgttgcgagggaagcgagatggcacttttcttgtccgggag
agcagtaaacagggctgctacgcctgctctgtagtggtggacggtgaagtaaagcattgt
gtcataaacaaaacagcaactggctatggctttgccgagccctataacttgtacagctct
ctgaaagaactggtgctacattaccaacacacctccctcgtgcagcacaacgactccctc
aatgtcacactagcctacccagtatatgcacagcagaggcgatga

KEGG   Pan troglodytes (chimpanzee): 471079
Entry
471079            CDS       T01005                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05010  Alzheimer disease
ptr05017  Spinocerebellar ataxia
ptr05020  Prion disease
ptr05100  Bacterial invasion of epithelial cells
ptr05132  Salmonella infection
ptr05135  Yersinia infection
ptr05142  Chagas disease
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05163  Human cytomegalovirus infection
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex virus 1 infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    471079 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    471079 (PIK3CB)
   04014 Ras signaling pathway
    471079 (PIK3CB)
   04015 Rap1 signaling pathway
    471079 (PIK3CB)
   04370 VEGF signaling pathway
    471079 (PIK3CB)
   04630 JAK-STAT signaling pathway
    471079 (PIK3CB)
   04668 TNF signaling pathway
    471079 (PIK3CB)
   04066 HIF-1 signaling pathway
    471079 (PIK3CB)
   04068 FoxO signaling pathway
    471079 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    471079 (PIK3CB)
   04072 Phospholipase D signaling pathway
    471079 (PIK3CB)
   04071 Sphingolipid signaling pathway
    471079 (PIK3CB)
   04024 cAMP signaling pathway
    471079 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    471079 (PIK3CB)
   04152 AMPK signaling pathway
    471079 (PIK3CB)
   04150 mTOR signaling pathway
    471079 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    471079 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    471079 (PIK3CB)
   04218 Cellular senescence
    471079 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    471079 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    471079 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    471079 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    471079 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    471079 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    471079 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    471079 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    471079 (PIK3CB)
   04660 T cell receptor signaling pathway
    471079 (PIK3CB)
   04662 B cell receptor signaling pathway
    471079 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    471079 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    471079 (PIK3CB)
   04670 Leukocyte transendothelial migration
    471079 (PIK3CB)
   04062 Chemokine signaling pathway
    471079 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    471079 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    471079 (PIK3CB)
   04929 GnRH secretion
    471079 (PIK3CB)
   04915 Estrogen signaling pathway
    471079 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    471079 (PIK3CB)
   04917 Prolactin signaling pathway
    471079 (PIK3CB)
   04926 Relaxin signaling pathway
    471079 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    471079 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    471079 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    471079 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    471079 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    471079 (PIK3CB)
   04722 Neurotrophin signaling pathway
    471079 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    471079 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    471079 (PIK3CB)
   04380 Osteoclast differentiation
    471079 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    471079 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    471079 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    471079 (PIK3CB)
   05206 MicroRNAs in cancer
    471079 (PIK3CB)
   05205 Proteoglycans in cancer
    471079 (PIK3CB)
   05203 Viral carcinogenesis
    471079 (PIK3CB)
   05230 Central carbon metabolism in cancer
    471079 (PIK3CB)
   05231 Choline metabolism in cancer
    471079 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    471079 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    471079 (PIK3CB)
   05212 Pancreatic cancer
    471079 (PIK3CB)
   05225 Hepatocellular carcinoma
    471079 (PIK3CB)
   05226 Gastric cancer
    471079 (PIK3CB)
   05214 Glioma
    471079 (PIK3CB)
   05221 Acute myeloid leukemia
    471079 (PIK3CB)
   05220 Chronic myeloid leukemia
    471079 (PIK3CB)
   05218 Melanoma
    471079 (PIK3CB)
   05211 Renal cell carcinoma
    471079 (PIK3CB)
   05215 Prostate cancer
    471079 (PIK3CB)
   05213 Endometrial cancer
    471079 (PIK3CB)
   05224 Breast cancer
    471079 (PIK3CB)
   05222 Small cell lung cancer
    471079 (PIK3CB)
   05223 Non-small cell lung cancer
    471079 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    471079 (PIK3CB)
   05017 Spinocerebellar ataxia
    471079 (PIK3CB)
   05020 Prion disease
    471079 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    471079 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    471079 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    471079 (PIK3CB)
   04931 Insulin resistance
    471079 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    471079 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    471079 (PIK3CB)
   05135 Yersinia infection
    471079 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    471079 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    471079 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    471079 (PIK3CB)
   05161 Hepatitis B
    471079 (PIK3CB)
   05160 Hepatitis C
    471079 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    471079 (PIK3CB)
   05164 Influenza A
    471079 (PIK3CB)
   05162 Measles
    471079 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    471079 (PIK3CB)
   05163 Human cytomegalovirus infection
    471079 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    471079 (PIK3CB)
   05169 Epstein-Barr virus infection
    471079 (PIK3CB)
   05165 Human papillomavirus infection
    471079 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    471079 (PIK3CB)
   05142 Chagas disease
    471079 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    471079 (PIK3CB)
   01524 Platinum drug resistance
    471079 (PIK3CB)
   01522 Endocrine resistance
    471079 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    471079 (PIK3CB)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     471079 (PIK3CB)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    471079 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C
Other DBs
NCBI-GeneID: 471079
NCBI-ProteinID: XP_003950253
Ensembl: ENSPTRG00000015452
VGNC: 2512
UniProt: A0A6D2XVS3 K7DEK7
LinkDB
Position
3
AA seq 1070 aa
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDSLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEVSGKNDHIWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKE
ILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALGNRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcagtttcataatgcctcctgctatggcagacatccttgacatctgggcggtg
gattcacagatagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcttatattaagcagatgttatgg
aagcaagttcacaattacccaatgttcaacctccttatggatattgactcctatatgttt
gcatgtgtgaatcagactgctgtatatgaggagcttgaagatgaaacacgaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgattccttg
aaggatcctgaagtaaatgaatttcgaagaaaaatgcgcaaattcagcgaggaaaaaatc
ctgtcacttgtgggattgtcttggatggactggctaaaacaaacatatccaccagagcat
gaaccatccatccctgaaaacttagaagataaactttatgggggaaagctcatcgtagct
gttcattttgaaaactgccaggacgtgtttagctttcaagtgtctcctaatatgaatcct
atcaaagtaaatgaattggcaatccaaaaacgtttgactattcatgggaaggaagatgaa
gttagcccctatgattatgtgttgcaagtcagcgggagagtagaatatgtttttggtgat
catccactaattcagttccagtatatccggaactgtgtgatgaacagggccctgccccat
tttatacttgtggaatgctgcaagatcaagaaaatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaatcttcctcttccattaccaccaaagaaaaca
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaggaaactgtaaaagttcatgtcagggctggtctttttcatggt
actgagctcctgtgtaaaaccatcgtaagctcagaggtatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatattaatatttgtgacttaccaagaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacgaagaaatcaacgaaaactatt
aatccctctaaatatcagaccatcaggaaagctggaaaagtgcattatcctgtagcgtgg
gtaaatacgatggtttttgactttaaaggacaattgagaactggagacataatattacac
agctggtcttcatttcctgatgaactcgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatgttaaatttccagagaataaaaaa
caaccttattattaccctcccttcgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtgtcaagtcgaggtggaaaaaagtttcttcctgtattgaaagaa
atcttggacagggatcccttgtctcaactgtgtgaaaatgaaatggatcttatttggact
ttgcgacaagactgccgagagattttcccacaatcactgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcgctgcttcagatttggcctaaa
ctgcccccccgggaggccctagagcttctggatttcaactatccagaccagtacgttcga
gaatatgctgtaggctgcctgcgacagatgagtgatgaagaactttctcaatatctttta
caactggtgcaagtgttaaaatatgagccttttcttgattgtgccctctctagattccta
ttagaaagagcacttggtaatcggaggatagggcagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacaatttggtgtcatccttgaagcatactgccgg
ggaagtgtggggcacatgaaagtgctttctaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgccgtgaagttaaacagagccaaagggaaggag
gccatgcatacctgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cccctgaacccatgtgttatcctctcagaactctatgttgaaaagtgcaaatacatggat
tccaaaatgaagcctttgtggctggtatacaataacaaggtatttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaggatatgttgacactccaaatgttg
cgcttgatggatttactctggaaagaagctggtttggatcttcggatgttgccttatggc
tgtttagcaacaggagatcgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgctgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggaa
tttacactgtcctgtgctggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaaatccaagtttggcattaaaagggagcgagtgccttttattctt
acctatgatttcatccatgtcattcaacaaggaaaaacaggaaatacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcgctgatgttgactgcagggcttcctgaactcacatcagtcaaagat
atacagtatcttaaggactctcttgcattaggaaagagtgaagaagaagcactcaaacag
tttaagcaaaaatttgatgaggcgctcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

DBGET integrated database retrieval system