KEGG   Pan troglodytes (chimpanzee): 456526Help
Entry
456526            CDS       T01005                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00020  Citrate cycle (TCA cycle)
ptr00190  Oxidative phosphorylation
ptr01100  Metabolic pathways
ptr01200  Carbon metabolism
ptr04714  Thermogenesis
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr05010  Alzheimer disease
ptr05012  Parkinson disease
ptr05016  Huntington disease
Module
ptr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ptr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    456526 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    456526 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    456526 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    456526 (SDHB)
   05012 Parkinson disease
    456526 (SDHB)
   05016 Huntington disease
    456526 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    456526 (SDHB)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     456526 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 456526
NCBI-ProteinID: XP_001155516
Ensembl: ENSPTRG00000000242
VGNC: 8101
UniProt: H2PY56
LinkDB All DBs
Position
1
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggcgccggttaccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccacagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system