Pan troglodytes (chimpanzee): 457261 Help Entry 457261            CDS       T01005                                  Symbol HIST2H2AC Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr03082   ATP-dependent chromatin remodeling ptr04217   Necroptosis ptr04613   Neutrophil extracellular trap formation ptr05034   Alcoholism ptr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     457261 (HIST2H2AC)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     457261 (HIST2H2AC)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     457261 (HIST2H2AC)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     457261 (HIST2H2AC)   09165 Substance dependence    05034 Alcoholism     457261 (HIST2H2AC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     457261 (HIST2H2AC)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptr04147]     457261 (HIST2H2AC) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     457261 (HIST2H2AC) Exosome [BR:ptr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    457261 (HIST2H2AC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A Motif Other DBs NCBI-GeneID:  457261 NCBI-ProteinID:  XP_513764 Ensembl:  ENSPTRG00000052021 VGNC:  14365 UniProt:  A0A2I3TSY0 A0A6D2XJF4 LinkDB All DBs Position 1:124599924..124600375 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaaacaaggaggcaaggcccgcgccaaggccaagtcgcgctcgtcc cgcgctggcctccagttcccggtagggcgagtgcaccgcttgctgcgcaaaggcaactac gcggagcgggtaggggccggcgcgcccgtctacatggcggcggtcctcgagtacctgacc gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc cctcgtcacctccagctggccatccgcaacgacgaggaactgaacaagctgctgggtaaa gtcaccatcgcccagggcggcgttttgcctaacatccaggccgttctgttaccaaagaaa accgaaagccacaaagccaaaagcaaataa

DBGET integrated database retrieval system