KEGG   Pan troglodytes (chimpanzee): 457425
Entry
457425            CDS       T01005                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2 isoform X1
  KO
K12966  absent in melanoma 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04621  NOD-like receptor signaling pathway
ptr04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    457425 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    457425 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon DUF2950
Other DBs
NCBI-GeneID: 457425
NCBI-ProteinID: XP_016785481
Ensembl: ENSPTRG00000001519
LinkDB
Position
1
AA seq 348 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVANLMIQNAGAVS
AVMKTIRIFQKLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHAKPEQKQMVAQQESIREGFQKGCLPVMVLKAKKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRIIIISRYYQHSGFLEVNSASRVLDAESDQKVNVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDNTGKMEVLVVRNED
TMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVGTAWNKVNSPRG
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatatcgccacaggcaaacta
catactgcaaacagaatacaagtagctaacttgatgattcaaaatgctggggcggtgtct
gcagtgatgaagaccattcgtatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagcaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcgcaaag
caacgtgctgcaccaaaagtctctcctcatgctaagcctgaacagaaacagatggtggcc
cagcaggaatctatcagagaagggtttcagaaaggctgtttgccagttatggtactgaaa
gcaaagaagcccttcacgtttgagacccaagaaggcaagcaggagatgtttcatgctaca
gtggctacagaaaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaataattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagtgcctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtcccactg
aacattatcagaaaagctggtgaaaccccgaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatggtttgtttgtagtccagaaggtaacagaaaagaagaaaaatgta
ttatttgacctaagtgacaacactgggaaaatggaagtactggtggttagaaacgaggac
acaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatagcaccataaaggtgggaactgcatgg
aacaaagtcaactctccaagggggtga

DBGET integrated database retrieval system