KEGG   Pan troglodytes (chimpanzee): 457477Help
Entry
457477            CDS       T01005                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00480  Glutathione metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01524  Platinum drug resistance
ptr05200  Pathways in cancer
ptr05204  Chemical carcinogenesis
ptr05225  Hepatocellular carcinoma
ptr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    457477 (MGST3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    457477 (MGST3)
   00982 Drug metabolism - cytochrome P450
    457477 (MGST3)
   00983 Drug metabolism - other enzymes
    457477 (MGST3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    457477 (MGST3)
   05204 Chemical carcinogenesis
    457477 (MGST3)
   05225 Hepatocellular carcinoma
    457477 (MGST3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    457477 (MGST3)
  Drug resistance
   01524 Platinum drug resistance
    457477 (MGST3)
Enzymes [BR:ptr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     457477 (MGST3)
Transporters [BR:ptr02000]
 Other Transporters
  Pores ion channels [TC:1]
   457477 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 457477
NCBI-ProteinID: XP_001174626
Ensembl: ENSPTRG00000001616
VGNC: 6916
UniProt: K7BTG1
LinkDB All DBs
Position
1
AA seq 151 aa AA seqDB search
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI
ALLGLVGTTVCSAFQHLGWVKSGLGSGPKCH
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggaatatggttttgtgcttctaactggtgctgccagctttata
atggtggcccacctagccatcaatgtttccaaggcccgcaagaagtacaaagtggagtat
cctatcatgtacagcacggaccctgaaaatgggcacatcttcaactgcattcagcgagcc
caccagaacacgttggaagtgtatcctcccttcttattttttctagctgttggaggtgtt
taccacccgcgtatagcttctggcctgggcttggcctggattgttggacgagttctttat
gcttatggctattacacaggagaacccagcaagcgtagtcgaggagccctggggtccatc
gccctcctgggcttggtgggcacaactgtgtgctctgctttccagcatcttggttgggtt
aaaagtggcttgggcagtggacccaaatgccattaa

DBGET integrated database retrieval system