KEGG   Pan troglodytes (chimpanzee): 457564Help
Entry
457564            CDS       T01005                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04020  Calcium signaling pathway
ptr04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    457564 (CACNA1E)
   04020 Calcium signaling pathway
    457564 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    457564 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptr04040]
    457564 (CACNA1E)
Ion channels [BR:ptr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   457564 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 457564
NCBI-ProteinID: XP_016789172
Ensembl: ENSPTRG00000001749
VGNC: 11749
LinkDB All DBs
Position
1
AA seq 2458 aa AA seqDB search
MVPEMRGLSPDRRLPEPAPCPAAGSPEPRSAGRRQRHVLALPEEEAWRPQQCALLEADAS
DEVGMLPASPRAASGFDSFFQVQEGEGQGWEGAMALEAGSSPFLPVSPEVMKRRRGGLIE
QRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQ
AAAYKQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMI
LATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSY
LRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIM
KAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPA
GYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLI
IIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVML
AEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGV
SYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLF
LGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALR
LLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGT
PSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLL
NVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHH
MSMWEPRSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEAPTMNPLNPLNPLS
SLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLS
LGQREPPWLARPCHGNCDPTQQEAGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSS
ASRSRSASQERSLDEAMPTEGEKDHELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGL
AGGLDEADTPLVLPHPELEVGKHVVLTEQEPEGSSEQALLGNVQLDMGRVISQSEPDLSC
ITANTDKATTESTSVTVAIPDVDPLVDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKK
QKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDP
VLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALV
AFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIV
YKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHY
DNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFV
NIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFV
VSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFL
NYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRI
LLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLML
LFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLML
NLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPL
GLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSEL
QKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKN
APMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPA
DDGQFQERQSLEPEVSELKSVQPSNHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPS
SMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDT
HRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGT
GSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSEEGSPL
TSQALESNNACLTESSNSPHPQQSQHASPQRYISEPYLALHEDSHASDCGEEETLTFEAA
VATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 7377 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggactgagcccagaccgcaggctgcccgagcccgccccctgc
ccggctgcggggagccctgagcccaggtccgcgggccgccgccaacgccacgtcctggcc
ctgccggaagaagaggcatggcggccccagcagtgcgctctgctcgaggccgacgcctcg
gacgaggtgggcatgctgccggcttccccgcgcgccgcctctggcttcgacagcttcttc
caggtgcaggagggcgagggccagggctgggagggcgccatggcactggaggcgggctcc
agccctttcctgccggtgagccccgaggtcatgaagcggcggcgcgggggcctcatcgag
cagcgcgacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcccgg
cgcaaggaatgggagatggctcgcttcggggaggcggtggtcgccaggccagggtccggc
gatggagactcggaccagagcaggaaccggcaaggaacccccgtgccggcctcggggcag
gcggccgcctacaagcagacgaaagcgcagagggcgcggactatggctttgtacaacccc
attcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcggagaagat
aacattgtcaggaaatatgccaagaagctcatcgattggccgccatttgagtacatgatc
ctggccaccatcattgccaactgcatcgtcctggccctggagcagcatcttcctgaggat
gacaagacccccatgtcccgaagactggagaagacagaaccttatttcattgggatcttt
tgctttgaagctgggatcaaaattgtggccctggggttcatcttccataagggctcatac
ctccgcaatggctggaatgtcatggacttcatcgtggtcctcagtggcatcctggccact
gcaggaacccacttcaatactcatgtggacctgaggaccctccgggctgtgcgtgtcctg
cggcccttgaagctcgtgtcagggatacctagcctgcagattgtgttgaagtccatcatg
aaggccatggtacctcttctgcagattggccttctgctcttctttgccatcctgatgttt
gctatcattggtttggagttctacagtggcaagttacatcgagcatgcttcatgaacaat
tcaggtattctagaaggatttgacccccctcacccatgtggtgtgcagggctgcccagct
ggttatgaatgcaaggactggatcggccccaatgatgggatcacccagtttgataacatc
ctttttgctgtgctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctg
tacaataccaatgatgccttaggagccacctggaattggctgtacttcatccccctcatc
atcattggatccttctttgttctcaacctagtcctgggagtgctttccggggaatttgcc
aaagagagagagagagtggagaaccgaagggctttcatgaagctgcggcgccagcagcag
attgagcgtgagctgaatggctaccgtgcctggatagacaaagcagaggaagtcatgctc
gctgaagaaaataaaaatgctggaacatccgctttagaagtgcttcgaagggcaaccatc
aagaggagccggacagaggccatgactcgagactccagtgatgagcactgtgttgatatc
tcctctgtgggcacacctctggcccgagccagtatcaaaagtgcaaaggtagatggggtc
tcttatttccggcacaaggaaaggcttctgcgcatctccattcgccacatggttaaatcc
caggtgttttactggattgtgctgagccttgtggcactcaacactgcctgtgtggccatt
gtccatcacaaccagccccagtggctcacccacctcctctactatgcagaatttctgttt
ctgggactcttcctcttggagatgtccctgaagatgtatggcatggggcctcgcctttat
tttcactcttcattcaactgctttgattttggggtcacagtgggcagtatctttgaagtg
gtctgggcaatcttcagacctggtacgtcttttggaatcagtgtcttgcgagccctccgg
cttctaagaatatttaaaataaccaagtattgggcttccctacggaatttggtggtctcc
ttgatgagctcaatgaagtctatcatcagtttgcttttcctcctcttcctcttcatcgtt
gtctttgctctcctaggaatgcagttatttggaggcaggtttaactttaatgatgggact
ccttcggcaaattttgataccttccctgcagccatcatgaccgtgttccagatcctgacg
ggtgaggactggaatgaggtgatgtacaatgggatccgctcccagggtggggtcagctca
ggcatgtggtctgccatctacttcattgtgctcaccttgtttggcaactacacgctactg
aatgtgttcttggctatcgctgtggataatctcgccaacgcccaggaactgaccaaggat
gaacaggaggaagaagaggccttcaaccagaaacatgcactgcagaaggccaaggaggtc
agcccgatgtctgcacccaacatgccttcgatcgaaagagacagaaggagaagacaccac
atgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcaccacatg
tccgtgtgggagcagcgtaccagccagctgaggaagcacatgcagatgtccagccaggag
gccctcaacagagaggaggcaccgaccatgaacccgctcaaccccctcaacccgctcagc
tccctcaacccgctcaatgcccaccccagcctttatcggcgacccagggccattgagggc
ctggccctgggcctggccctggagaagttcgaggaggagcgcatcagccgtggggggtcc
ctcaagggggatggaggggaccgatccagtgccctggacaaccagaggacccctttgtcc
ctgggccagcgggagccaccgtggctggccaggccctgtcatggaaactgtgacccgact
cagcaggaggcagggggaggagaggctgtggtgacctttgaggaccgggccaggcacagg
cagagccaacggcgcagccggcatcgccgcgtcaggacagaaggcaaggagtcctcttca
gcctcccggagcaggtctgccagccaggaacgcagtctggatgaagccatgcccactgaa
ggggagaaggaccatgagctcaggggcaaccatggtgccaaggagccaacgatccaagaa
gagagagcccaggatttaaggaggaccaacagtctgatggtgtccagaggctccgggctg
gcaggaggccttgatgaggctgacacccccctagtcctgccccatcctgagttggaagtg
gggaagcacgtggtgctgacggagcaggagccagaaggcagcagtgagcaggccctgctg
gggaatgtgcagctagacatgggccgggtcatcagccagagcgagcccgacctctcctgc
atcacggccaacacggacaaggccaccactgagagcaccagcgtcaccgtcgccatcccc
gacgtggaccccttggtggactcaaccgtggtgcacattagcaacaagacggatggggaa
gccagtcccttgaaggaggcagagatcagagaggatgaggaggaggtggagaagaagaag
cagaagaaggagaagcgtgagacaggcaaagccatggtgccccacagctcaatgttcatc
ttcagcaccaccaacccgatccggagggcctgccactacatcgtgaacctgcgctacttt
gagatgtgcatcctcctggtgattgcagccagcagcatcgccctggcggcagaggacccc
gtcctgaccaactcggagcgcaacaaagtcctgaggtattttgactatgtgttcacgggc
gtgttcacctttgagatggttataaagatgatagaccaaggcttgatcctgcaggatggg
tcctacttccgagacttgtggaacatcctggactttgtggtggtcgttggcgcactggtg
gcctttgctctggcgaacgctttgggaaccaacaaaggacgggacatcaagaccatcaag
tctctgcgggtgctccgagttctaaggccactgaaaaccatcaagcgcttgcccaagctc
aaggccgtcttcgactgcgtagtgacctccttgaagaatgtcttcaacatactcattgtg
tacaagctcttcatgttcatctttgctgtcatcgcagttcagctcttcaagggaaagttc
ttttattgcacggacagttccaaggacacagagaaggagtgcataggcaactatgtagat
catgagaaaaacaagatggaggtgaagggccgggaatggaagcgccatgaattccactac
gacaacattatctgggccctgctgaccctcttcaccgtctccacaggggaaggatggcct
caagttctgcagcactctgtagatgtgacagaggaagaccgaggcccaagccgcagcaac
cgcatggagatgtctatcttttatgtagtctactttgtggtcttccccttcttctttgtc
aatatctttgtggctctcatcatcatcaccttccaggagcaaggggataagatgatggag
gagtgcagcctggagaagaatgagagggcgtgcatcgacttcgccatcagcgccaaacct
ctcacccgctacatgccgcagaacagacacaccttccagtaccgcgtgtggcactttgtg
gtgtctccgtcctttgagtacaccattatggccatgatcgccttgaataccgttgtgctg
atgatgaagtattactctgctccctgtacctatgagctggccctgaagtacctgaatatc
gccttcaccatggtgttttccctggaatgtgtcctgaaggtcatcgcttttggctttttg
aactatttccgagacacctggaatatctttgacttcatcaccgtgattggcagtatcaca
gaaattatcctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctg
aagctcttccgagctgcccgcctcataaagctcctgcgtcagggctataccatacgcatt
ttgctgtggacctttgtgcagtcctttaaggccctcccttatgtctgccttttaattgcc
atgcttttcttcatttatgccatcattgggatgcaggtatttggaaacataaaattagac
gaggagagtcacatcaaccggcacaacaacttccggagtttctttgggtccctaatgcta
ctcttcaggagtgccacaggtgaagcctggcaggagattatgctgtcatgccttggggag
aagggctgtgagcctgacaccaccgcaccatcagggcagaacgagaacgaacgctgcggc
accgatctggcctacgtgtactttgtctccttcatcttcttctgctccttcttgatgctc
aacctgttcgtggccgtcatcatggacaactttgagtacctgactcgggactcctccatc
ctggggcctcaccacttggacgagtttgtccgcgtctgggcagaatatgaccgagcagca
tgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcacctccgcta
ggcctcggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaacatg
ccagtagctgaggacatgacggtccacttcacctccacacttatggctctgatccggaca
gctctggacattaaaattgccaaaggtggtgcagacaggcagcagctagactcagagcta
caaaaggagaccctagccatctggcctcacctatcccagaagatgctggatctgcttgtg
cccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatg
gactactataagcagagtaaggtgaagaagcagaggcagcagctggaggaacagaaaaat
gcccccatgttccagcgcatggagccttcatctctgcctcaggagatcattgctaatgcc
aaagccctgccttacctccagcaggaccccgtttcaggcctgagtggccggagtggatac
ccttcgatgagtccactctctccccaggatatattccagttggcttgtatggaccccgcc
gatgatggacagttccaagaacggcagtctctggagccagaggttagtgaattaaaaagc
gtgcagccctctaaccatggcatctaccttccttcggacacccaggagcatgcgggatct
gggagggcatcttctatgccacgtctgactgtggatccccaggtggtgacagaccctagc
tccatgagacgttcattttccactattcgggataagcgttcaaattcctcgtggttggag
gaattctccatggagcgaagcagtgaaaatacctacaagtcccgtcgccggagttaccac
tcctccttgcggctgtcagcccaccgcctgaactctgattcaggccacaagtctgacact
caccgctcagggggcagggagcggggacggtcaaaagagcgaaagcatcttctctctcct
gatgtctcccgctgcaattcagaagagcgagggacccaggctgactgggagtccccagag
cgccgtcaatccaggtcacccagtgagggcaggtcacagacgcccaacagacagggcaca
ggttccctaagtgagagctccatcccctctgtctctgacaccagcaccccaagaagaagt
cgtcggcagctcccacccgtcccgccaaagccccggcccctcctttcctacagctccctg
attcgacacgcgggcagcatctctccacctgctgatggaagcgaggagggctccccgctg
acctcccaagcactggagagcaacaatgcttgcctgaccgagtcttccaactctccgcac
ccccagcagagccaacatgcctccccacagcgctacatctccgagccctacttggccctg
cacgaagactcccatgcctcagactgtggtgaggaggagacgctcactttcgaagcagcc
gtggctactagcctgggccgttccaacaccatcggctcagccccacccctgcggcatagc
tggcagatgcccaacgggcactatcggcggcggaggcgcgggggccctgggccaggcatg
atgtgtggggctgtcaacaacctgctaagtgacacggaagaagatgacaaatgctag

DBGET integrated database retrieval system