KEGG   Pan troglodytes (chimpanzee): 458044Help
Entry
458044            CDS       T01005                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    458044 (TGM6)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     458044 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 458044
NCBI-ProteinID: XP_016792705
Ensembl: ENSPTRG00000013175
VGNC: 6282
UniProt: A0A2I3RYS4
LinkDB All DBs
Position
20
AA seq 746 aa AA seqDB search
MPLASTELPGLKPTGLRQRIGEDCIIQLSGGRGLISLSSPHPGIRVTKVDWQRSRNGAAH
HTQEYPCPELVVRRGQSFSLTLELSRALDCEETLIFTVETGPQASEALHTKAVFQTSELE
QGEGWTAAREAQMENTLTVSLASPPSAVIGRYLLSIRLSSHRKHSNRRLGEFVLLFNPWC
AEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYGQFQEDILDICLSILDRSPGH
QNNPATDVSCRHNPIYVTRVISAMVNSNNDRGVVQGQWQGKYGGGTSPLHWRGSVAILQK
WLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSAHDTDQNLSVDKYVDSFGRT
LEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREG
DVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKIGRCISTKAVGSDSRVDITDL
YKYPEGSRKERQVYSKAVNRLFGVEASGRRTWIRRAGGRCLWRDDLLEPATKPSIAGKFK
VLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTRKPVAEILHESHAVRRGPQEE
KRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEKDITLEDFITIKVLGPAMVGV
AVTVEVTVVNPLIERVKDCALMAEGSGLLQEQLSIDVPTLEPQERASVQFDITPSKSGPR
QLQVDLVSPHFPDIKGFVIVHVATAK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcttcaacagagcttccagggctcaagcccactggcctgagacaaagaatt
ggggaggattgtatcattcagctctctggaggccgtggcctcatctccctgtcctctccc
cacccagggatcagagtcaccaaggtagactggcagcggtcgaggaatggtgctgcccac
cacacccaggagtacccctgccctgagctggtggttcgcaggggccagtcgttcagcctc
acgctggagctgagcagagccctggactgtgaggagaccctcatcttcacggtggagaca
ggaccccaggcttctgaggccctccacaccaaagctgtgttccagacatcggagctggag
cagggtgagggctggacagcagcaagggaggctcagatggagaacactctgaccgtcagt
ctcgccagccctcccagtgctgtcattggccgctacctgctgagcatcagactttcctct
caccgcaaacacagcaaccggaggctgggcgagtttgttctccttttcaacccatggtgt
gcagaggacgatgtgtttctggcctcagaggaggagagacaggagtacgtgctcaacgac
agcggcatcatcttccgaggcgtggagaagcacatacgagcccagggctggaactacggg
cagtttcaggaggacatcctggacatctgtctctccatcctggatcgaagccccggtcac
caaaacaacccagccaccgacgtgtcctgccgccacaaccccatctacgtcaccagggtc
atcagtgccatggtgaacagcaacaacgaccggggtgtggtgcaaggacagtggcagggc
aagtacggcggcggcaccagcccgctgcactggcgcggcagcgtggccattctgcagaag
tggctcaagggcaggtacaagccagtcaagtacggccagtgctgggtcttcgcgggagtc
atgtgcacagtcctcaggtgcttggggatagccacacgggtcgtgtccaacttcaactca
gcccacgacacagaccagaacctgagtgtggacaaatacgtggactccttcgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctaggcccctcttacaatggctggcaggttctggatgccaccccccag
gaggagagtgaaggtgtgttccggtgcggcccagcctcagtcaccgccatccgcgaaggt
gatgtgcacctggcccacgatggccccttcgtgtttgcggaggtcaacgccgactacatc
acctggctgtggcacgaggatgagagccgggagcgtgtatactcaaacacgaagaagatt
gggagatgcatcagcaccaaggcggtgggcagtgactcccgcgtggacatcaccgacctc
tacaaatatccggaagggtcccggaaagagaggcaggtgtacagcaaggcggtgaacagg
ctgttcggcgtggaagcctctggaaggagaacctggatccgcagggctggggggcgctgt
ctctggcgtgacgacctcctggagcctgccaccaagcccagcatcgctggcaagttcaag
gtgctagagcctcccatgctgggccacgacctgagactggccctgtgcttggccaacctc
acctcccgggcccagcgggtgagggtcaacctgagcggtgccaccatcctctatacccgc
aagccagtggcagagatcctgcatgaatcccacgccgtgaggcgggggccgcaagaagag
aagagaatcccaattacaatatcttactctaagtataaagaagacctgacagaggacaag
aagatcctgttggctgccatgtgccttgtcaccaaaggagagaagcttctggtggagaag
gacattactctagaggacttcatcaccatcaaggttctgggcccagccatggtgggagtg
gcagttacagtggaagtgacagtagtcaaccccctcatagagagagtgaaggactgtgcg
ctgatggcggagggcagcggccttctccaggaacagctcagcatcgacgtgcctaccctg
gagcctcaggagagggcctcagtccagtttgacatcaccccctccaaaagtggcccaagg
cagctgcaggtggaccttgtaagccctcacttcccggacatcaagggctttgtgatcgtc
catgtggccactgccaagtga

DBGET integrated database retrieval system