Pan troglodytes (chimpanzee): 458156 Help Entry 458156            CDS       T01005                                  Gene name BCL2L1 Definition (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ptr  Pan troglodytes (chimpanzee) Pathway ptr01521   EGFR tyrosine kinase inhibitor resistance ptr01524   Platinum drug resistance ptr04014   Ras signaling pathway ptr04064   NF-kappa B signaling pathway ptr04115   p53 signaling pathway ptr04137   Mitophagy - animal ptr04140   Autophagy - animal ptr04151   PI3K-Akt signaling pathway ptr04210   Apoptosis ptr04215   Apoptosis - multiple species ptr04621   NOD-like receptor signaling pathway ptr04630   JAK-STAT signaling pathway ptr05012   Parkinson disease ptr05014   Amyotrophic lateral sclerosis ptr05022   Pathways of neurodegeneration - multiple diseases ptr05145   Toxoplasmosis ptr05162   Measles ptr05166   Human T-cell leukemia virus 1 infection ptr05168   Herpes simplex virus 1 infection ptr05170   Human immunodeficiency virus 1 infection ptr05200   Pathways in cancer ptr05202   Transcriptional misregulation in cancer ptr05212   Pancreatic cancer ptr05220   Chronic myeloid leukemia ptr05222   Small cell lung cancer ptr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ptr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     458156 (BCL2L1)    04630 JAK-STAT signaling pathway     458156 (BCL2L1)    04064 NF-kappa B signaling pathway     458156 (BCL2L1)    04151 PI3K-Akt signaling pathway     458156 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     458156 (BCL2L1)    04137 Mitophagy - animal     458156 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     458156 (BCL2L1)    04215 Apoptosis - multiple species     458156 (BCL2L1)    04115 p53 signaling pathway     458156 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     458156 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     458156 (BCL2L1)    05202 Transcriptional misregulation in cancer     458156 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     458156 (BCL2L1)    05225 Hepatocellular carcinoma     458156 (BCL2L1)    05220 Chronic myeloid leukemia     458156 (BCL2L1)    05222 Small cell lung cancer     458156 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     458156 (BCL2L1)    05014 Amyotrophic lateral sclerosis     458156 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     458156 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     458156 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     458156 (BCL2L1)    05162 Measles     458156 (BCL2L1)    05168 Herpes simplex virus 1 infection     458156 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     458156 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     458156 (BCL2L1)    01524 Platinum drug resistance     458156 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptr01009]     458156 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptr03036]     458156 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ptr02000]     458156 (BCL2L1) Protein phosphatases and associated proteins [BR:ptr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      458156 (BCL2L1) Chromosome and associated proteins [BR:ptr03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     458156 (BCL2L1) Transporters [BR:ptr02000]  Other transporters   Pores ion channels [TC:1]    458156 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  458156 NCBI-ProteinID:  XP_003316946 Ensembl:  ENSPTRG00000013359 VGNC:  9824 UniProt:  H2QK53 A0A6D2VVP1 LinkDB All DBs Position 20 AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system