KEGG   Pan troglodytes (chimpanzee): 458629
Entry
458629            CDS       T01005                                 

Gene name
IL17RA
Definition
(RefSeq) interleukin-17 receptor A isoform X1
  KO
K05164  interleukin 17 receptor A
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    458629 (IL17RA)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    458629 (IL17RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptr04050]
    458629 (IL17RA)
   04090 CD molecules [BR:ptr04090]
    458629 (IL17RA)
Cytokine receptors [BR:ptr04050]
 Interleukin receptor families
  IL17 receptor family
   458629 (IL17RA)
CD molecules [BR:ptr04090]
 Proteins
  458629 (IL17RA)
SSDB
Motif
Pfam: IL17R_fnIII_D1 IL17R_fnIII_D2 SEFIR
Other DBs
NCBI-GeneID: 458629
NCBI-ProteinID: XP_016795111
Ensembl: ENSPTRG00000014033
VGNC: 5981
LinkDB
Position
22
AA seq 1044 aa
MEGACGAGEAPAGVDASPTRVQLEARRARPRRSAPGARGRRRAGEGRRKDWGGTPGGLSV
GPRGGAQGGTGGGPCLTLNPSPSQTKLLPSARPAPGPGLEAGSEQSGADSNSTAEKKASE
RSLAASPAGAEPSATPPGPWGPHAARRPLSRGPCWGCSCCSWACWPRVAPPCDSWTTGRW
SAPSRESLLPTSDRSPAMPLQVQAVSYSHPQEGSRRIVDACTCASCREHSLCKSTCLDDS
WIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNT
NERLCVRFEFLSKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFL
VPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHME
NHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSATV
SCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTKY
TDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAIS
EAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFTA
AMNMILPDFKRPACFGSYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLEM
FQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPSL
DEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVREEGGAAVAKLEPHLQPRGQPA
PQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLPV
DPEDSPLGSTPMASPDLLPEDVREHLEGLMLSLFQQSLSCQAQGGCSRPAMVLTDPHTPY
EEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQ
LLFRQLQKNSGWDTMGSESERPSA
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggagggtgcatgtggggcaggcgaggctccagctggagttgacgctagcccgacgcgg
gtgcaactggaggcgcgacgggccaggcccaggaggagcgcacctggggcgcgcggccgg
aggagggccggggagggacgccggaaggactggggagggacgccgggaggactgagcgta
gggccgagaggaggggcgcaaggaggaacggggggagggccctgtctcaccctaaacccc
tccccgtcccagactaaactcctcccctcggcccggcccgcccctgggcccgggctggaa
gccggaagcgagcaaagtggagccgactcgaactccaccgcggaaaagaaagcctcagaa
cgttcgctcgctgcgtccccagccggggccgagccctccgcgacgccaccggggccatgg
gggccgcacgcagcccgccgtccgctgtcccggggcccctgctggggctgctcctgctgc
tcctgggcgtgctggccccgggtggcgcctccctgcgactcctggaccaccgggcgctgg
tctgctcccagccgtgagagcctgctgccaacttctgacagaagtcctgccatgccactc
caggttcaggctgtgagctacagccatccgcaggagggttcccggagaattgtggatgcg
tgcacctgcgcttcctgtcgagaacattcattatgcaaaagtacctgcctggatgacagc
tggattcaccctcgaaacctgaccccctcctccccaaaggacctgcagatccagctgcac
tttgcccacacccaacaaggagacctgttccccgtggctcacatcgaatggacactgcag
acagacgccagcatcctgtacctcgagggtgcagagttatctgtcctgcagctgaacacc
aatgaacgtttgtgcgtcaggtttgagtttctgtccaaactgaggcatcaccacaggcgg
tggcgttttaccttcagccactttgtggttgaccctgaccaggaatatgaggtgaccgtt
caccacctgcccaagcccatccctgatggggacccaaaccaccagtccaagaatttcctt
gtgcctgactgtgagcacgccaggatgaaggtaaccacgccatgcatgagctcaggtagc
ctgtgggaccccaacatcaccgtggagaccctggaggcccaccagctgcgtgtgagcttc
accctgtggaacgaatctacccattaccagatcctgctgaccagttttccgcacatggag
aaccacagttgctttgagcacatgcaccacatacctgcgcccagaccagaagagttccac
cagcgatccaacgtcacgctcactctacgcaaccttaaagggtgctgtcgccaccaagtg
cagatccagcccttcttcagcagctgcctcaatgactgcctcagacactccgcgactgtt
tcctgcccagaaatgccagacactccagaaccaattccggactacatgcccctgtgggtg
tactggttcatcacgggcatctccatcctgctggtgggctccgtcatcctgctcatcgtc
tgcatgacctggaggctagctgggcctggaagtgaaaaatacagtgatgacaccaaatac
accgatggcctgcctgcggctgacctgatccccccaccgctgaagcccaggaaggtctgg
atcatctactcagccgaccaccccctctacgtggacgtggtcctgaaattcgcccagttc
ctgctcaccgcctgcggcacggaagtggccctggacctgctggaagagcaggccatctcg
gaggcaggagtcatgacctgggtgggccgtcagaagcaggagatggtggagagcaactct
aagatcatcgtcctgtgctcccgcggcacgcgcgccaagtggcaggcgctcctgggccgg
ggggcgcctgtgcggctgcgctgcgaccacggaaagcccgtgggggacctgttcactgca
gccatgaacatgatcctcccggacttcaagaggccagcctgcttcggcagctacgtagtc
tgctacttcagcgaggtcagctgtgacggcgacgtccccgacctgttcggcgcggcgccg
cggtacccgctcatggacaggttcgaggaggtgtacttccgcatccaggacctggagatg
ttccagccgggccgcatgcaccgcgtaggggagctgtcgggggacaactacctgcggagc
ccgggcggcaggcagctccgcgccgccctggacaggttccgggactggcaggtccgctgt
cccgactggttcgaatgtgagaacctctactcggcagatgaccaggatgccccgtccctg
gacgaagaggtgtttgaggagccactgctgcctccgggaaccggcatcgtgaagcgggcg
cccctggtgcgcgagcctggctcccaggcctgcctggccatagacccgctggtcagggag
gaaggaggagcagcagtggcaaagctggaacctcacctgcagccccggggtcagccagcg
ccgcagcccctccacaccctggtgctcgccgcagaggagggcgccctggtggccgcggtg
gagcctgggcccctggctgacggtgccgcagtccggctggcactggcgggggagggcgag
gcctgcccgctgctgggcagcccgggcgctgggcgaaatagcgtcctcttcctccctgtg
gaccccgaggactcgccccttggcagcacccccatggcgtctcctgacctccttccagag
gacgtgagggagcacctcgaaggcttgatgctctcgctcttccagcagagtctgagctgc
caggcccaggggggctgcagtagacccgccatggtcctcacagacccacacacgccctac
gaggaggagcagcggcagtcagtgcagtctgaccagggctacatctccaggagctccccg
cagccccccgagggactcacggaaatggaggaagaggaagaagaggagcaggacccaggg
aagccggccctgccactctctcccgaggacctggagagcctgaggagcctccagcggcag
ctgcttttccgccagctgcagaagaactcgggctgggacacgatggggtcagagtcagag
aggcccagtgcatga

DBGET integrated database retrieval system