KEGG   Pan troglodytes (chimpanzee): 459070
Entry
459070            CDS       T01005                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00230  Purine metabolism
ptr01100  Metabolic pathways
ptr01522  Endocrine resistance
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04114  Oocyte meiosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04371  Apelin signaling pathway
ptr04540  Gap junction
ptr04611  Platelet activation
ptr04713  Circadian entrainment
ptr04714  Thermogenesis
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04727  GABAergic synapse
ptr04740  Olfactory transduction
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04916  Melanogenesis
ptr04918  Thyroid hormone synthesis
ptr04921  Oxytocin signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04925  Aldosterone synthesis and secretion
ptr04926  Relaxin signaling pathway
ptr04927  Cortisol synthesis and secretion
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr04962  Vasopressin-regulated water reabsorption
ptr04970  Salivary secretion
ptr04971  Gastric acid secretion
ptr04972  Pancreatic secretion
ptr04976  Bile secretion
ptr05032  Morphine addiction
ptr05163  Human cytomegalovirus infection
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    459070 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    459070 (ADCY3)
   04371 Apelin signaling pathway
    459070 (ADCY3)
   04020 Calcium signaling pathway
    459070 (ADCY3)
   04072 Phospholipase D signaling pathway
    459070 (ADCY3)
   04024 cAMP signaling pathway
    459070 (ADCY3)
   04022 cGMP-PKG signaling pathway
    459070 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    459070 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    459070 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    459070 (ADCY3)
   04062 Chemokine signaling pathway
    459070 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    459070 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    459070 (ADCY3)
   04912 GnRH signaling pathway
    459070 (ADCY3)
   04913 Ovarian steroidogenesis
    459070 (ADCY3)
   04915 Estrogen signaling pathway
    459070 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    459070 (ADCY3)
   04921 Oxytocin signaling pathway
    459070 (ADCY3)
   04926 Relaxin signaling pathway
    459070 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    459070 (ADCY3)
   04918 Thyroid hormone synthesis
    459070 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    459070 (ADCY3)
   04916 Melanogenesis
    459070 (ADCY3)
   04925 Aldosterone synthesis and secretion
    459070 (ADCY3)
   04927 Cortisol synthesis and secretion
    459070 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    459070 (ADCY3)
   04270 Vascular smooth muscle contraction
    459070 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    459070 (ADCY3)
   04971 Gastric acid secretion
    459070 (ADCY3)
   04972 Pancreatic secretion
    459070 (ADCY3)
   04976 Bile secretion
    459070 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    459070 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    459070 (ADCY3)
   04727 GABAergic synapse
    459070 (ADCY3)
   04725 Cholinergic synapse
    459070 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    459070 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    459070 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    459070 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    459070 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    459070 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    459070 (ADCY3)
   04714 Thermogenesis
    459070 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    459070 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    459070 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    459070 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    459070 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    459070 (ADCY3)
   05163 Human cytomegalovirus infection
    459070 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    459070 (ADCY3)
Enzymes [BR:ptr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     459070 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 459070
NCBI-ProteinID: XP_016803639
Ensembl: ENSPTRG00000011718
VGNC: 7
UniProt: A0A6D2XHA3 H2QHJ5
LinkDB
Position
2A
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPGNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDSRLPLVPSK
YSMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgctttatgcggctgactttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctcaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacattgtgggctttactcagctgtcttctgcctgcagtgcccaggagctt
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgaggattaagatcctgggcgactgctactactgcatctgcggcttgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggtaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacgtcggagaagcccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggatgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcatggtgggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcaacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccggcaatgcaacggcaggg
atggagacggagggcagctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcaggcgccgtggccaccatcaacctctatgcctggcgccccgtctttgat
gaatacgaccacaagcgttttcgggagcacgacttacctatggtggccttagagcagatg
caaggattcaaccctgggctcaatggcactgacagcaggctgcccctggtgccttccaag
tactctatgacggtgatggtgttcctcatgatgctcagcttctactacttctcccgccac
gtagaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtttatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggtggtattgagtgtctgcgtttcctcaatgaaatcatctcggatttt
gactctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagc
acgtatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagctcc
aacaaggaagacaagtccgagagagagcgctggcagcacctggctgacctggccgacttc
gcgctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcattggagcccggaaacca
cactacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgc
tttgtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttg
aaggggcgggataagctagccaccttccccaatggcccctctgtcacactgccccaccag
gtggtggacaactcctga

DBGET integrated database retrieval system