KEGG   Pan troglodytes (chimpanzee): 459394Help
Entry
459394            CDS       T01005                                 

Gene name
LSP1
Definition
(RefSeq) lymphocyte-specific protein 1 isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04625  C-type lectin receptor signaling pathway
ptr05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    459394 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    459394 (LSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon FAM70 DUF45
Motif
Other DBs
NCBI-GeneID: 459394
NCBI-ProteinID: XP_016775648
LinkDB All DBs
Position
11
AA seq 346 aa AA seqDB search
MKPLVAWRMGALRAASVGRAFRDVRPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGG
HVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPE
GEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQP
RTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQ
YTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSK
KSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctctggttgcgtggaggatgggagcgcttcgggcagcatctgtgggcagagcc
ttcagggatgtgaggcccactgctcagtggagcgtggaggacgaggaggaggctgtccac
gagcaatgccagcatgagagagacaggcagcttcaggcgcaggacgaggagggaggcggc
catgtccccgagcggccgaagcaggagatgctcctcagcctgaagccctcggaggcccct
gaactggatgaggacgagggctttggcgactggtcccagaggccagagcagcggcagcag
cacgagggggcgcagggcgccttggacagcggagagcccccccagtgcaggagtcctgag
ggggagcaagaggacaggcccggcctgcatgcctacgaaaaggaggacagtgacgaagtc
cacctggaggagttgagtctgagcaaggaggggccaggcccagaggacactgtccaggac
aacctgggggccgcaggggctgaggaggaacaggaggagcaccagaaatgtcagcagccc
agaacacccagccccttggtcttggaggggaccatcgaacagagctcgcctcccctgagc
cctaccaccaaactcatcgacaggaccgagtccctaaaccgctccatagagaagagtaac
agtgtgaagaaatcccagccagacttgcccatctccaagattgatcagtggctggaacaa
tacacccaggccatcgagaccgctggccggacccccaagctagcccgccaggcctccata
gagctgcccagcatggctgtggccagtaccaagagtcggtgggagacgggtgaggtacag
gctcagtctgcggccaagactccgtcctgcaaggatattgtggctggagacatgagcaag
aaaagcctctgggagcagaagggaggctccaagacctcatcaacaattaagagcacccca
tctgggaagaggtataagtttgtggccaccgggcatgggaagtatgagaaggtgcttgtg
gaagggggcccggctccctag

DBGET integrated database retrieval system