KEGG   Pan troglodytes (chimpanzee): 459991
Entry
459991            CDS       T01005                                 

Gene name
CCL20
Definition
(RefSeq) C-C motif chemokine 20 isoform X2
  KO
K14625  C-C motif chemokine 20
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04061  Viral protein interaction with cytokine and cytokine receptor
ptr04062  Chemokine signaling pathway
ptr04657  IL-17 signaling pathway
ptr04668  TNF signaling pathway
ptr05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    459991 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    459991 (CCL20)
   04061 Viral protein interaction with cytokine and cytokine receptor
    459991 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    459991 (CCL20)
   04062 Chemokine signaling pathway
    459991 (CCL20)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    459991 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    459991 (CCL20)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Chemokines
   459991 (CCL20)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 459991
NCBI-ProteinID: XP_009442757
Ensembl: ENSPTRG00000012999
VGNC: 125
UniProt: A0A2J8NFH2
LinkDB
Position
2B
AA seq 95 aa
MCCTKSLLLAALMSVLLLHLCSESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDIN
AIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
NT seq 288 nt   +upstreamnt  +downstreamnt
atgtgctgtaccaagagtttgctcttggctgctttgatgtcagtgctgctactgcacctc
tgcagcgaatcagaagcaagcaactttgactgctgtcttggatacacagaccgtattctt
catcctaaatttattgtgggcttcacacggcagctggccaatgaaggctgtgacatcaat
gctatcatctttcacacaaagaaaaagttgtctgtgtgcgcaaatccaaaacagacttgg
gtgaaatatattgtgcgtctcctcagtaaaaaagtcaagaacatgtaa

DBGET integrated database retrieval system